fluency in multiple languages Jobs

Our company is seeking a talented Software Engineer to join our team. As a Software Engineer, you will be responsible for designing, developing, and maintaining software solutions that meet the n...
softwaresoftware engineeringdevelopmentsoftware engineers

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

JOB DESCRIPTION: Location - Gurgaon Experience- 4 Years Must Skills - Dynamics 365, Dot Net, CRM Work from Office profile. Shift: General shift (Cab provided), Work from Offic...
crm.netdynamics 365

Job Role – Android developer (mobile devices and TV). Preferred domain experience: OTT , Media , Video , Audio space Good analytical ability to attack problems that are very unusual and ex...
AndroidAndroid StudioJavaAndroid frameworkJavaJavaJavaScriptJSONHTMLKotlinFireTv

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Production Manager Job Responsibilities:
• Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Dear Candidate, Greetings from HCL Tech.!! HCL is Hiring for SNOW Developer Minimum 8 years Relevant ServiceNow Experience. Responsible for handling escalations, participates in escalation mee...
angular jsjdbcjavascripthtmlcssservicenowsnow

• • Software Test Engineer Responsibilities Meeting with development managers to discuss software specifications and controls. Using the software as intended...
    testingsoftware engineering

Our client is a 5-year-old online platform where one can buy exclusive range of handcrafted clothing and accessories, home decor and more. Their textiles and designs range from Patola, Kalamkari...
ppcgoogle adwords

We are looking for an organized, flexible Clinical Research Associate to oversee clinical trials. The Clinical Research Associate will develop and outline trial protocols, establish trial sites, ...
clinical research associatesclinical data managementclinical researchclinical trialsclinical monitoring

ServiceNow development architecture technical soln design, Experience across multiple products to be checked in various JL5 prospects apart of ITSM eg. HRSD, IRM, ITOM, CSM, SECOPS, AIOPS, SP...
service nowitsm

1. Required experience of Solution selling for entire for APAC Region Oil and Gas
2. Experience in handling multiple projects and working as techno commercial role i...
   project managementengineering

Dear Candidates, We are hiring for the position of Vulnerability Management (CrowdStrike and Qualys) at LTI Mindtree
• 6 years of Vulnerability Mana...
  qualysowaspvulnerability managementrapid7

We are looking for an AngularJS developer responsible for building Angular applications. Your primary responsibility will be to create user information solutions by developing, implementing, and m...
javajquerysql serversqlenvironmentuser requirementsinformation solutionsrestdesignfeaturesangularjscomponentsvalidationinterfacesarchitecturetroubleshootingangularEnd User Research

Must be from Premier / A Grade Engineering Colleges, B-Schools 7-12 years of experience in Oracle ERP IT/ERP Project, Program Management Global Experience Experience of ERP implementations, ...
project managementagileprogram managementmanagementdeliverydata managementanalytical skillspeople managementerp implementationserporaclebalancepremierbusinessinventoryanalytical

<ul> Software Engineer Exp- 2 to 4years Np -15days to Immediate Mandatory skills Experience & working knowledge in SQL, Unix/Linux & RDBMS. Incident management tool Servi...

Understand Architecture Requirements and ensure effective design, development, Validation and support activities Analyzing user requirements, envisioning system features and functionality. Identif...
javajquerysql serversqlenvironmenttest casesproblem solvinguser requirementsquality processesagile methodologiessoftware developmentarchitectural patternsperformance engineeringautomated testingsdlcagilebasictests

We are looking for a Mainframe Senior developer responsible for building Mainframe applications. Your primary responsibility will be to create user information solutions by developing, implementin...
javajquerysql serversqlenvironmenttest casesproblem solvinguser requirementsquality processesagile methodologiesinformation solutionsperformance engineeringsdlcrestagilebasiccodesdesignfeatures

Experience in Assembler in development or modernization of assembler programs into high level programming languages such as Cobol/Java/C#. Experience in executing projects in agile methodology. Sh...
problem solvingdesign patternscapacity planningperformance tuningthought leadershiparchitectural designsolution developmentprogramming languagesdigital transformationcompetency developmentdb2jclimsfitcicssdlcrexxpl1cobol

Sr Principal Engineer-Electrical This is where you save and sustain lives At Baxter, we are deeply connected by our mission. No matter your role at Baxter, your...
javajavascriptequipment supplyframeworksafety criticallinux

Scrum Master Qualifications A candidate must possess at least a bachelors degree in computer science or related field to be considered for a Scrum Master job role. Working knowledge of Agile m...
agile methodologyscrum agile development methodology

We are seeking a skilled and innovative Software/Industrial Automation Engineer to join our team. The Software/Industrial Automation Engineer will be responsible for de...
programmingautomationladderjavahmisindustrialscadapythonsystemslogic

1. Provide assistance, administer and coordinate in the use of computer hardware, software and any other specialized computer/information technology or operate a multi-p...
   erpconfigurationsystems

• Responds to Customer Complaints.
• Evaluates and Resolves Problems of Customers.
• Assists In Instal...
  service engineeringrepairmaintenance