Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Description : Willingness and ability to delight the customers Ability to understand customer needs Good communicator- both written and in speech Pro-active behavior Polite and a good listener...
servicelevels fax set cargo imp buying business monit spreadsheets communication ServiceCatalog ServiceLevelManagement Escalation ServiceOperations ContactCenterManagement IncidentManagement Service ing MajExperience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagement
Job Summary:
Ecommerce Manager India is responsible for the sales and online activations contributing to the growth of Ecommerce accoun...
new business developmentnew business consumer goodsbrand marketing online platformssenior management content managementbusinessWe are looking for an Assistant Manager Sales that will handle the following : Regular visit to customers ( cha - fwd / priority importer & exporters) offices for selling products of L / T CUSOM CLEA...
sales mis accounts tat banking hpdataprotector seniormanagement hp his cha cfs icd div ltd house visit credit import selling xportDescription : Willingness and ability to delight the customers Ability to understand customer needs Good communicator- both written and in speech Pro-active behavior Polite and a good listener Go...
service levelscustomer service faxset cargoimport buyingbusiness monitoringspreadsheetDescription : Willingness and ability to delight the customers Ability to understand customer needs Good communicator- both written and in speech Pro-active behavior Polite and a good listener Go...
service levelscustomer service faxset cargoimport buyingbusiness monitoringspreadsheet Container Freight Station (CFS) experience for Exporter/Importer.
Must have Two-wheeler with valid Licence.
...
Description : Willingness and ability to delight the customers Ability to understand customer needs Good communicator- both written and in speech Pro-active behavior Polite and a good listener...
servicelevels fax set cargo imp buying business monit spreadsheets communication ServiceCatalog ServiceLevelManagement Escalation ServiceOperations ContactCenterManagement IncidentManagement Service ing Maj
Job Summary:
Ecommerce Manager India is responsible for the sales and online activations contributing to the growth of Ecommerce accoun...
new business developmentnew business consumer goodsbrand marketing online platformssenior management content managementbusiness
Job Summary:
Ecommerce Manager India is responsible for the sales and online activations contributing to the growth of Ecommerce accoun...
new business developmentnew business consumer goodsbrand marketing online platformssenior management content managementbusinessMarketing Executive at POST A RESUME (10 Opening) CTC Salary: 1.80 LPA TO 2.00 LPA Designation: Marketing Executive Job Location: Ahmedabad No. of Requirements: 10 Two Wheeler Required Yes Required...
marketingsales customer relationsbusiness development advertisingfood products behavioral training Requirement:
-To develop and execute effective sales and marketing plans based on market status and trend to reach projected result and perfo...
Logistics , Freight forwarding , Sales , BD , Marketing , International (Import , Export) To develop and execute effective sales and marketing plans based on market status and trend to reach projecte...
sales insurance marketing usinessplanning localsales salesmarketing cargoinsurance businessdevelopment marketinganalysis newbusinessacquisition newbusinessExperience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagementMarketing Executive at POST A RESUME (10 Opening) CTC Salary: 1.80 LPA TO 2.00 LPA Designation: Marketing Executive Job Location: Ahmedabad No. of Requirements: 10 Two Wheeler Required Yes Required...
marketingsales customer relationsbusiness development advertisingfood products behavioral trainingExperience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagementMain Purpose: Focus on all controlling matters of the organization covering the international business Knowledge Skills and Abilities, Key Responsibilities:
Intern...
customer relationsreporting basisaccounts researchinternational trade finance trade financeproblem solving Need Sales/Marketing/Distt Manager.
Salary Basis 15,000 - 25,000 + incentives + Allowance.
Sample can be provided for Further reference.
We are the Wholeseller,Supplie...
Requirement:
-To develop and execute effective sales and marketing plans based on market status and trend to reach projected result and perfo...
Job Description- Company Name: Banking Designation : Relationship Manager Emerging Corporate -Trade & Forex Location : Pune ,Nasik ,Kolhapur, Solapur & Delhi Salary Range : Decent Hike on ...
salesmarketing insurancecustomer relations bankingbusiness banking export salaryimpoCompany Profile: Company is a group of an experienced, young, dynamic & versatile professionals since 1997. Company is a distinguished importer and distributor of branded food stuffs & hold strong pr...
modern tradeaccounting direct taxcommunication skills accountstax accounting softwarebank reconciliation
27 - Sep - 2019
IT Applications Analyst - Document ManagementAS - IN - Pune
Job Description and Qualifications
POSITION SUMMARY:
...
Marketing Executive at POST A RESUME (10 Opening) CTC Salary: 1.80 LPA TO 2.00 LPA Designation: Marketing Executive Job Location: Ahmedabad No. of Requirements: 10 Two Wheeler Required Yes Required...
marketingsales customer relationsbusiness development advertisingfood products behavioral trainingLogistics , Freight forwarding , Sales , BD , Marketing , International (Import , Export) To develop and execute effective sales and marketing plans based on market status and trend to reach projecte...
sales insurance marketing usinessplanning localsales salesmarketing cargoinsurance businessdevelopment marketinganalysis newbusinessacquisition newbusinessExperience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagementDear Candidates :- Urgent Opening forMale E-Commerce Executive in Pitampura, Delhi Experience:Min 3 Year. Company Profile :Importer & Exporter of cosmetic Product du...
customer returnssales order salarysales order processing work ordersapplications welfare-to-workexport Dear Candidate,
greetings!!!
we are Looking Candidates for Different Positions with One of Medical Equipment Importer Based At Delhi Ncr, Working At Pan India Since 1997.please ...
Dear Candidate,
greetings!!!
we are Looking Candidates for Different Positions with One of Medical Equipment Importer Based At Delhi Ncr, Working At Pan India Since 1997.please ...
Position - Account Executive Location Navi Mumbai Vashi Experience Min 1 years to 6 Years
Dear Candidate,
we are Looking Candidates for Different Positions with One of Medical Equipment Importer Based At Delhi Ncr, Working At Pan India Since 1997.please Check the Details and if...
27 - Sep - 2019
IT Applications Analyst - Document ManagementAS - IN - Pune
Job Description and Qualifications
POSITION SUMMARY:
...
We are mahal enterprise importer of aluminium window hardware we are distrubuting our material all over india please visit more information
Responsibilities and Duties
Responsibi...
Experience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagementDear Candidate, We are looking for Project Engineer For Faridabad Location , who do have hands on Knowledge of Pipe line & Fittings, Knowledge of Autocad / Ironcad, Knowledge of MS Office & Open Offi...
bom customerrelations processengineering safety projectplanning mechanicalengineering design projectengineeringmanagement siteengineering projectcoordination projectestimation commissioning inspection costestimation pipingdesign rojectenginMarketing Executive at POST A RESUME (10 Opening) CTC Salary: 1.80 LPA TO 2.00 LPA Designation: Marketing Executive Job Location: Ahmedabad No. of Requirements: 10 Two Wheeler Required Yes Required...
marketingsales customer relationsbusiness development advertisingfood products behavioral trainingLogistics , Freight forwarding , Sales , BD , Marketing , International (Import , Export) To develop and execute effective sales and marketing plans based on market status and trend to reach projecte...
sales insurance marketing usinessplanning localsales salesmarketing cargoinsurance businessdevelopment marketinganalysis newbusinessacquisition newbusiness Headquartered in Mumbai Since 2012, Leading Importer of Excellent Quality Usa & Canadian Roofing Shingles is Looking to Hire Area Sales Manager (maharashtra & Gujarat) for Its Mumbai Office.
Experience 4 to 7 years (experience in the field of Sales, Operations) Domain preference Freight forwarding/ custom broking / Container Depot) EXIM containerized Logistics Qualification MBA from a...
sales marketing businessdevelopment finance dsa newproductideas timemanagement projectplanning dailyoperations analyticalskills productknowledge requirementgathering customersatisfaction kf cemanagementLogistics , Freight forwarding , Sales , BD , Marketing , International (Import , Export) To develop and execute effective sales and marketing plans based on market status and trend to reach projecte...
sales insurance marketing usinessplanning localsales salesmarketing cargoinsurance businessdevelopment marketinganalysis newbusinessacquisition newbusinessCOMPANY - A IMPORTER & DISTRIBUTOR OF LAPTOP, DESKTOP , PRINTER REQUIRES HARDWARE ENGINEER. ! WE DO NOT CHARGE CANDIDATES ! IMMEDIATE JOINING ! LOCATION-NEAR CHANDNI METRO, KOLKATA POSITION - HARDW...
maintenanceetworksupportCOMPANY - A IMPORTER OF PRINTER & BAR CODING EQUIPMENT AT SECTOR- V REQUIRES FEMALE ACCOUNTANT. ! WE DO NOT CHARGE CANDIDATES ! IMMEDIATE JOINING ! LOCATION- SECTOR- V, SALT LAKE POSITION - FEMALE ...
nternal auditmaintain books of accountsWe have a great opportunity with our client for Sales Executive Find the details below Client :Topmost strapping manufacturers in India and a packaging machine importer specializing in packaging m...
b2ceadgenerationsalesexecutiveactivitiesb2bmarketingb2bsalessalesprocesskeyaccountmanagementcorporatesalesb2cmarketingsalescoordinationDear Candidate Greetings from MangnumBPMC!! As discussed,Kindly find the details for the opening with Drupal Devloper location.Thane Location Details Position -Drupal Developer/Web Developer Requ...
drupalmysqljquerycssphpwebdevelopmentctcbranddesignpayrolltemplateresidentialavailabilityXHTMLWebStandardsLAMPContentManagementSystemsrontendDevelopmentCrossbrowserCompatibilityRequired Operations Executive for Freight Fowarding Co. - Sea operations. Candidate should have experience in shipping operations mainly import documentation and operations. Profile :- Candidate sh...
correspondenceadministrationsalesdraftingoperationscommunicationshippingreightforwardingcustomerservicemsofficeRequired Operations Executive for Freight Fowarding Co. - Sea operations. Candidate should have experience in shipping operations mainly import documentation and operations. Profile :- Candidate sh...
correspondenceadministrationsalesdraftingoperationscommunicationshippingreightforwardingcustomerservicemsofficeInterview for the post of Assembly Technician / Repairing Engineer Job Location: Gurgaon Company Address: Allied Medical Ltd. 76 - 77 , Udyog Vihar Phase 4 , Gurgaon. Job Profile: Candidate shall ...
inspectionqualitysafetytroubleshootingmechanicaltheatreanesthesiaelectronicsanaesthesiantensivecareoperationtheatreelectronicscircuitscareexpsalaryimpmedicalcircuitsemergencyassembliesWe Aryan HRD Solutions Pvt. Ltd. a leading consultancy in India since 2006. We would like to inform you that we have current opening for the post of Sales Engineer / Officer with one of our esteem cl...
salesmarketingusinessdevelopment Mangalam Exportbiz Pvt. Ltd. Deals in home decor products, Presenting wide range of WALLPAPERS and Artificial Grass. We are the leading importer & Manufacturer providing the best quality of product.
Mangalam Exportbiz Pvt. Ltd. Deals in home decor products, Presenting wide range of WALLPAPERS and Artificial Grass. We are the leading importer & Manufacturer providing the best quality of product.
Diamond Importer & Exporter Accountant (DE- 3584- S4) Candidate should be Graduate(B.COM). Should have 1 years of experience in same field. Job timimg : 9.00AM to 7.00PM. Salary : Upto Rs. 150...
typingfilingdraftingschedulingcustomerservicemanagementcustomerrelationshiphelpdeskeetingfacilitationvendtelephonysupppersonalassistanceexpsalaryimpvendaccessgatewaytelephonymanageme© 2019 Hireejobs All Rights Reserved