interpret financial statements jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

interpret financial statements Job Openings

Showing 10101 - 10150 of 29792 Jobs

Pre Sales Executive

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:

Experience Required:

Location: presalestele sales

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Cnc Machinist
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Faridabad, Ambala, Hyderabad, Dhubri, Chandigarh, Bhillai, Silvassa, Guwahati 01 Apr, 2025

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Audit Associate
Emrys Creatives 3.00 to 7.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description EMRYS Global LLC offers professional services in tax, accounts audit, legal consulting, and outsourcing. The company provides clever solutions for various financial problems u...
financial statement analysisfinancial auditsanalytical skills

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Graphic Designer
Thought Factory Design 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

The ideal candidate is a creative team player, talented at visualisation and an Adobe software expert. You will be responsible for developing marketing and communications content that will separat...
marketingcontent developmentpresentation skillsAdobe IllustratorAdobe PhotoshopvisualisationAdobe softwarecommunications

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Delhi,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates, Hy 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

French Language Expert
Wehire Talent Solutions 0.00 to 4.00 Years Delhi,Noida, Bangalore, Nellore, Hyderabad, Other Andhra Pradesh, Pondicherry, Gurugram, Pune, Mumba 01 Apr, 2025

Job Title: French Language Interpreter (Remote) Salary: Up to 11 LPA CTC (Based on interview performance and last drawn salary) We are looking...
english writingb2 certification in frenchfrench speaking

Equity Dealer
Apex Services Hiring For One of the leading broking firm 2.00 to 5.00 Years Delhi,Faridabad, Noida, Jaipur, Jodhpur, Gurugram 01 Apr, 2025

JD Relationship Manager- Dealing:- As part of the retail distribution team, the role holder is responsible to provide compliant financial advisory services to clients and...
dematnismcross sellingstock market

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Ethiopia, Bangladesh, Anantpur, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Team Manager
ASHISH INVESTMENT SERVICES 15.00 to 25.00 Years Delhi 01 Apr, 2025

Profile: Associate Agency Development About the Company: Kotak Mahindra Life Insuranceis a fast-growing organization recognized for its100%succ...
salesbusiness developmentteam managementlead generation

Urgent Opening- Financial Planning & Analyst- Manufacturing Industry- Delhi
Topgear Consultants Private Limited 2.00 to 7.00 Years Delhi 01 Apr, 2025

Hiring with a leading Manufacturing industry for their office in Delhi. Role: Financial planning & Analysis Qualification - MBA/CA Location: Delhi analysisfinancial planningbudgetingplanningvariance analysisforecastingmodelling

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Software Developer - .NET Core - Coimbator
Forar Tech India Private Limited 3.00 to 7.00 Years Coimbatore,Other Tamil Nadu 01 Apr, 2025

Company Overview Forar Tech India Private Limited is a premium IT services company that specializes in technology staffing. We are known for our ability to find the most qualified candidates with...
SQL Server Management StudioBootstrapJavaScriptjQueryGitASPNET CoreASPNET MVC

Internal Auditor
WorkMint 0.00 to 4.00 Years Coimbatore,Thanjavur, Madurai, Thirunelveli, Salem, Tiruchirappalli, Nagercoil, Ooty, Erode, Cuddalo 01 Apr, 2025

WorkMint Hiring For Banking Internal Auditor Job Description conduct thorough financial audits, analyse data, identify discrepancies and provide rec...
audit planningauditingaudit management

Hiring for Unit Manager
Good Life Consultants Hiring For ICICI Prudential Life Insurance 1.00 to 6.00 Years Coimbatore 01 Apr, 2025

Hiring for a Leading Banking Corporate. Job Roles and Responsibilities : Unit Manager Role.

Identify & recruit right quality advisors to build a strong advisor base

Provide...
regulatory complianceproblem solvingcommunication skillscritical thinkingadaptabilityservice orientationactive learningsocial perceptivenesstime management

Associate Agency Manager
Aspire ERP Systems Hiring For Top MNC Life Insurance Company 10.00 to 17.00 Years Coimbatore,Pondicherry, Chennai, Hyderabad, Madurai, Srikakulam, Davanagere, Ongole, Vizianagaram, S 01 Apr, 2025

Dear Associate, Urgent openings in Top MNC Life Insurance Company To apply Call - hidden_mobile or Email cv to hidden...
insurance brokingdirect marketinglife insurancebfsi salesfield salesinsurance salesbanking salescross sellingdirect sales

Vacancy for medical coding
ISKILLS SOLUTIONS 0.00 to 1.00 Years Coimbatore,Pondicherry, Chennai, Tambaram, Vilupuram, Namakkal, Kumbakonam, Erode, Cuddalore, Karaik 01 Apr, 2025

Position: Medical Coder

Emp...
bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms

Operation Manager
BN Recruitment Services Hiring For Banking 2.00 to 7.00 Years Coimbatore,Davanagere, Bellary, Nellore, Vijayawada, Gulbarga, Vishakhapatnam, Belgaum, Mangalore, H 01 Apr, 2025

Hiring In Banking:
Operations Manager Our expanding company is seeking to hire an operations manager to join our leadership team. You wil...
communicationteam management skillsleadershipproblem solving

Vacancy for medical coding
ISKILLS SOLUTIONS 0.00 to 1.00 Years Chennai,Pondicherry, Cuddalore, Tambaram, Vilupuram, Coimbatore, Namakkal, Kumbakonam, Erode, Karaik 01 Apr, 2025

Position: Medical Coder

Emp...
bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Chennai,Bangalore, Hyderabad, Vijayawada, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Assistant Audit Manager
HOMEGENIE BUILDING PRODUCTS PRIVATE LIMITED Hiring For We Are Hiring! | Homegenie Building Products Pvt Ltd Join Our Growing Team of Assistant Audit Manage 8.00 to 11.00 Years Chennai 01 Apr, 2025

We Are Hiring! | Homegenie Building Products Pvt Ltd Join Our Growing Team of Assistant Audit Manager! Male Candidate preferred

stock audittds returninternal auditauditinggstincome tax audit

Financial Consultants for broking firm
QRN Services 1.00 to 6.00 Years Chennai,Bangalore, Other Karnataka 01 Apr, 2025

Post : Financial Consultant Company : Reputed broking firm Qualification: Graduate Locations: Bangalore, Chennai, Mangalore New Client Prospecting - Through cold-calling, appointments, refere...
equity tradingsalesinsuranceinvestmentbrokingnismcross sellingmutual funds

Finance Executive
EmpowerHire Associates Hiring For Forging Industry 4.00 to 5.00 Years Chennai 01 Apr, 2025

Required Fianance Executive & Senior Fianance Executive with 4 to 5 years of job experience. Candidate must have worked for any manufacturing company. Job location - Maraimalai Nagar Candidate ...
tds returnpayment postinggstaccount management

Equity Dealers
QRN Services 1.00 to 5.00 Years Chennai,Bangalore, Mangalore, Hubli 01 Apr, 2025

locations: Bangalore, Mangalore, Hubli, Hosur, Chennai, Company: A reputed broking firm Position:Equity Dealer Prime Responsibility Revenue generation from dealing & Other Product & Services ...
revenue generationshare marketclient acquisitionnismequitysecurities tradingmututal fundfinancial market

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Chennai,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Nagaon, Hyderabad, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Sales Manager
ICICI HOME FINANCE COMPANY LTD 1.00 to 6.00 Years Chennai,Bangalore, Hyderabad 01 Apr, 2025

Position Name:Sales Manager Exp Range: min. 1year of experience Salary Range: Upto 3.5 LPA Education:Full-time graduate or 10 ...
salesmortgage salesmortgage loanhome loansmortgage loans

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Ethiopia, Bangladesh, Anantpur, Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Chennai,Bangalore, Mohali, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

PREV
NEXT

interpret financial statements Job Openings

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i... cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Position: Medical Coder

Emp... bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms

Hiring In Banking:

Operations Manager Our expanding company is seeking to hire an operations manager to join our leadership team. You wil... communicationteam management skillsleadershipproblem solving

Position: Medical Coder

Emp... bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Emp...
bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms

Operations Manager Our expanding company is seeking to hire an operations manager to join our leadership team. You wil...
communicationteam management skillsleadershipproblem solving

Emp...
bptpharmacybiotechnologybiochemistryphysiotherapymicrobiologyzoologynursingbhms