llm architectures jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

llm architectures Job Openings

Showing 51 - 100 of 1232 Jobs

Senior Techno-Functional Project Manager

Fingent Fresher Kochi, Kerala 05 Nov, 2025

Solution Architecture

Critical Thinking

Interpersonal Skills

Project Management Expertise

Business Analysis Acumen

Embedded Software Engineer

Mobitech Wireless Solution Private Limited Fresher Erode, Tamil Nadu 05 Nov, 2025

Embedded Software Development

SAP Presales Solution Architect

Best Infosystems Ltd Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 03 Nov, 2025

sap

solution architecture

Cloud Platform Engineering Lead

Apple Fresher Hyderabad, Telangana 03 Nov, 2025

Cloud native solutions

Security concepts

DevSecOps practices

Internal Developer Portal

App

Capgemini is hiring for Datacom (L3/MPLS) Developer 3 to 8yrs - Chennai

CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai 03 Nov, 2025

Were Hiring: Datacom (L3/MPLS) Developer

Location:

Experience:

Your Role: Datacom Developer L3/MPLS linux

Lead - Observability Integration
Flexi Careers India Pvt Ltd Fresher Chennai 03 Nov, 2025

Primary Responsibilities Observability Integration Engineer Support development teams with OpenTelemetry instrumentation of application code, both zero-code and manual approaches. Assist in con...
monitoring toolsobservability

Full Stack .NET Developer
Talentelgia Technologies Fresher Mohali, Punjab 31 Oct, 2025

Role Overview: You are a .NET Developer with expertise in utilizing the latest .NET technologies to build applications. Your main focus will be on ASP.NET Core, .NET 6, Razor Pages, Entity Framewo...
AngularHTML5CSS3JavaScriptASPNET CoreNET 6Razor PagesEntity Framework CoreRESTful servicesReactVuejs

Staff Software Engineer - Backend (Adtech Team)
Warner Bros Discovery Fresher Pune, Maharashtra 30 Oct, 2025

Role Overview: Welcome to Warner Bros. Discovery, where dreams come true! As a Staff Software Engineer - Backend (Adtech Team) in Pune, you will be part of the Advertising Technology team dedicate...
JavaMicroservicesDesign patternsDockerKubernetesSQLNoSQLDynamoDBRedisElasticsearchKibanaUnit testingPerformance optimizationBackend software developmentEventdriven architecturessolutionsAWS servicesPostgres AuroraPrometheusCloudWatch

Staff Software Engineer - Backend
Warner Bros Discovery Fresher Pune, Maharashtra 30 Oct, 2025

You will be joining Warner Bros. Discovery as a Staff Software Engineer - Backend (Adtech Team) in Pune, contributing to revolutionizing the advertising landscape with a cutting-edge global ad pla...
JavaMicroservicesDesign patternsSQLNoSQLDockerKubernetesBackend software developmentEventdriven architecturessolutions

SENIOR ARCHITECT - ENGG
GEP Worldwide Fresher Hyderabad, Telangana 30 Oct, 2025

As a Technical Architect at our company, you will play a crucial role in designing and developing a secure, scalable, and resilient platform architecture for our award-winning cloud-based software...
JavaScriptMongoDBPostgreSQLMySQLAWSAzureDockerKubernetesNodejsTypeScriptExpressjsdesigning RESTful APIsmicroservices architecturesmessage queuescaching mechanismsGoogle Cloudfrontend technologies

Azure Data Architect
Hitachi Careers Fresher Pune, Maharashtra 28 Oct, 2025

Role Overview: As an Azure Data Architect at Hitachi Solutions, you will be responsible for designing and implementing end-to-end data solutions on Microsoft Azure. Your role will involve developi...
Microsoft AzureData GovernanceData PrivacySQLPythonScalaAzure DevOpsData ScienceData ModelingPower BIDatabase MigrationErwinData LakesData WarehousesETLELT ProcessesAzure SQL DatabaseAzure Synapse AnalyticsAzure Data Lake StorageAzure Da

Android System/ Software Architect
Tata Technologies Fresher Pune, Maharashtra 28 Oct, 2025

As an Android System / Software Architect with 8 to 13 years of experience, you will have a strong understanding of Android Automotives System/Software-Architecture across all major software layer...
Communication skillsAndroid Automotives SystemSoftwareArchitectureAOSP code baseCTSGAS certificationsAndroid Software development

SDE 3 - Backend
Snapmint Fresher Haryana 28 Oct, 2025

As a Backend SDE 3/Team Lead, you will lead a team of backend engineers, driving the development of scalable, reliable, and performant systems. You will work closely with product management, front...
databasesSQLNoSQLRESTful APIsAWSGCPAzureDockerKubernetesversion controlsystem architectureleadershipcommunicationinterpersonal skillsbackend developmentNodejscaching systemscloud platformscontainerization technologiessoftware developmen

Application Engineer III
Swiss Re Fresher Hyderabad, Telangana 28 Oct, 2025

Role Overview: As a Senior Back-end Technical Lead at Swiss Re, you will utilize design thinking techniques, software development skills, business domain knowledge, and agile architecture principl...
JavaSpring BootHibernateRESTful webservicesMS SQL ServerOracleAzureAWSDockerAzure DevOpsGoF Design PatternsPostgreSQL DBAPI designAPI managementMicroservices ArchitecturesAzure Kubernetes Service AKSCloud Application Architecture

Senior Solution Architect
Hitachi Careers Fresher Noida, Uttar Pradesh 28 Oct, 2025

Role Overview: As a Solution Architect at GlobalLogic, you will be responsible for designing and implementing scalable, cloud-native architectures, leveraging AI/GenAI capabilities, and ensuring b...
JavaSpring BootMicroservicesAWSAzureGCPDevOpsContainerizationAPI designAIMLGenerative AI modelsCICD pipelinesInfrastructure as CodeTerraform

Practice Head - DXP
Coforge Fresher Noida, Uttar Pradesh 28 Oct, 2025

We are hiring a Practice Head - DXP at Coforge with a strong background in Digital Experience Platforms. As a Practice Head, you will be responsible for developing and executing the vision, strate...
AEMContent Management SystemSitecoreDXP

Enterprise Architects Cognizant AI Agent Hub
Cognizant Fresher Chennai, Tamil Nadu 28 Oct, 2025

We are seeking a visionary Principal Architect with over 14 years of software engineering experience, particularly focused on AI/ML for at least 5 years, to take charge of designing, developing, a...
AngularPythonAWSAzureGCPFlaskDjangoJavaSQLNoSQLMongoDBCassandraReact

Next JS Developer
Grid Dynamics Fresher Chennai, Tamil Nadu 28 Oct, 2025

As a candidate for the position, you should possess the following technical skills: - Strong proficiency in Next.js (Latest, preferable Next 14 and above) and React.js. - Very good exposure on fr...
JavaScriptHTML5CSS3RESTful APIsGitNextjsReactjsTypeScriptReduxMobxWebpackBabel

Senior Gen AI Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 26 Oct, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad Required skills 5 years of professional experience in building Machine Learning models & systems...
machine learningartificial intelligencepythonlanggraphlangchainraggenerative ai

Senior Data Scientist
TIGI HR Fresher Udaipur, Rajasthan 23 Oct, 2025

Role Overview: As a Senior Data Scientist at our company, you will play a crucial role in leveraging data to power intelligent systems and breakthrough research. You will lead end-to-end ML projec...
Machine LearningDeep LearningPythonGenerative AIScikitlearnTensorFlowKerasPyTorchTransformer ArchitecturesLarge Language Models LLMsLangchain

Senior Node.js Engineer
Antal International, Delhi Fresher Udaipur, Rajasthan 23 Oct, 2025

As a Senior Node.js Engineer (Senior II) at our clients company, you will be responsible for leading and delivering multiple backend projects using Node.js (Express.js). You will play a crucial ro...
JavaScriptGitAgileOOPNodejsExpressjsCICD

Senior FPGA Engineer
Vicharak Fresher Surat, Gujarat 23 Oct, 2025

As a highly motivated and experienced Senior FPGA Engineer at Vicharak, you will be a crucial part of the core research and development team, focusing on advancing the performance, efficiency, and...
Performance AnalysisSystem IntegrationAccelerationSystem KnowledgeFPGA Architecture ResearchToolchain DevelopmentOptimizationLowLevel ImplementationInnovationPublicationCore FPGA SkillsTool Flow Expertise

Java API Microservices Integration Developer
People Prime Worldwide Fresher Kochi, Kerala 23 Oct, 2025

Role Overview: As a Java API Microservices Integration Developer, you will play a key role in designing, developing, and integrating scalable and secure APIs using Java-based microservices and RES...
JavaAPI developmentSpring BootDockerKubernetesJenkinsSQLMicroservices integrationRESTful API designSpring CloudSwaggerOpenAPINoSQL databasesOAuth2

Senior Software Engineer
Fingent Fresher Kochi, Kerala 23 Oct, 2025

You will be a Senior Software Engineer in the .NET domain at Fingent, where we believe in leveraging technology to create a positive impact on the lives of people. Our software solutions are desig...
jQueryEntity FrameworkLINQSQL AzureAppFabricCNETASPNET MVC FrameworkNet CoreAngular 2OOPS conceptsWeb API

Senior Front-End Developer
Phygital Insights Fresher Kochi, Kerala 23 Oct, 2025

As a Senior Front-End Developer, you will be responsible for leading the design and implementation of scalable, performant frontend architectures using Angular 14. You will drive best practices in...
HTML5CSS3LighthouseAngular 14TypeScriptModern JavaScript ES6ES7OOJSSCSSRESTful APIChromeDevToolsWeb Vitals

Laravel Developer
Lilac Infotech Pvt Ltd Fresher Kozhikode, Kerala 19 Oct, 2025

As a Laravel developer at our company, you will be responsible for managing the interchange of data between the server and the users. You should be highly resourceful and innovative with extensive...
PHPLaravelAJAXXMLJavaScriptRESTful APIsGitHTML5CSS3HTMLCSSServiceoriented architectures SOASoftware development life cycle SDLCOpen Stack technologies

Software Architect
MIST Global Fresher Kochi, Kerala 19 Oct, 2025

As a Software Architect at MIST, you will be responsible for designing and implementing scalable, high-performance software solutions that incorporate modern technologies, including AI and machine...
Machine LearningSystem ArchitectureAngularNETJavaPythonDatabase OptimizationCloud PlatformsAIdriven DevelopmentFrontend DevelopmentReactBackend DevelopmentNodejsAPI IntegrationCICD PipelinesCloudNative Solutions

Sr Computer Scientist - 2 (Architect)
Adobe Fresher Noida, Uttar Pradesh 19 Oct, 2025

As a Software Architect at Adobe, you will be instrumental in defining and evolving the architectural vision and roadmap for the products. Your role involves ensuring alignment with business goals...
JavaSpring BootMySQLPostgresMongoDBKafkaAWSAzureArtificial IntelligenceRest ServicesGenerative AI

Oracle/SQL /Java Engineer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai 19 Oct, 2025

Job Title:Senior Oracle/Sql / Java Engineer What You Will Do

As a key member of our technology team, you will be responsible for designing, developin...
oraclemicroservicesspring bootsql

iBwave RF Design Specialist
Relay Human Cloud India Fresher Ahmedabad, Gujarat 19 Oct, 2025

As a part of Relay Human Cloud, a dynamic company with operations in the US, India, Honduras, and Mexico, you will be involved in enabling top US-based companies to expand their teams internationa...
Project DocumentationLTECommunication SkillsiBwave DesignRF EngineerWireless System DesignCADRevitPropagation ModelingRF Benchmark Data AnalysisCarrier Submittal Packages5G NR

Business Intelligence Developer - Strategy
InfoCepts Fresher Nagpur, Maharashtra 14 Oct, 2025

As a candidate for the position, your role will involve helping end clients build sustainable reporting, analytic, and data solutions to meet business needs, create business value, and drive outco...
SQLBI toolsSDLCAgile developmentAnalytical skillsData warehousingData Warehouse ConceptsMSTR ArchitectureSchema designMicroStrategy development

Senior Software Engineer Java (Backend)
GLOINNT Solutions Pvt Ltd Fresher Mysore, Karnataka 14 Oct, 2025

As a Senior Software Developer Java, your role will involve designing, developing, and maintaining backend infrastructure, workflows, and services to provide easy-to-use solutions for Customer Sup...
JavaKafkaMicroservicesGCPPythonAPIEndpoint architecturesAir FlowCamundaTransactional databasesNoSQL datastores

.NET Junior Software Developer
ADCC Academy Fresher Nagpur, Maharashtra 10 Oct, 2025

Role Overview: As a Software Developer, you will work under the guidance of a Senior Software Developer. Your main responsibilities will include: - Participating in requirements analysis - Collabo...
JavascriptHTMLCSSJQueryAngularJSAngularOracleSQL ServerJoinsInterpersonal skillsNetworking skillsCommunication skillsPresentation skillsNET programming languagesServer technologiesarchitecturesWeb TechnologiesLanguagesWorkflow Development

Senior Android Developer
Code Tree Software Solutions Fresher Vijayawada, Andhra Pradesh 08 Oct, 2025

You have proven software development experience and Android skills. You have working experience in Android app development and have published at least one original Android app. You have experien...
RESTJSONAgile MethodologiesAndroid skills developmentAndroid app developmentAndroid SDKNDKthirdparty librariesAPIs

Engineering Manager
BuildingBlocks Software Services Fresher Chennai 08 Oct, 2025

We are looking for a driven and experienced Engineering Manager to lead our Integrations & Platform team. This is a engineering managementsnowflakeintegrationsci/cd

Data Services Engineering Lead - Assistant Vice President 2
State Street Fresher Hyderabad, Telangana 08 Oct, 2025

As a Data Services Engineering Lead joining our innovative development team, you will have the opportunity to lead the design and implementation of cutting-edge data solutions that drive business ...
JavaDistributed ComputingAzureData WarehousingSnowflakeApache SparkResource UtilizationStakeholder ManagementTeam LeadershipMicroservicesAPIsContainerizationDockerKubernetesHelmAWSCommunication SkillsGithubTeam ManagementPythonScala

Senior Python & Spark Developer
Best Infosystems Ltd Fresher Ahmedabad, Mumbai City 05 Oct, 2025

Senior Python & Spark Developer_full-time_Ahmedabad & Mumbai Job Title: Senior Python & Spark Developer Experience Required: 5 years Location: Ahmedabad preferred, but open for Mumbai Role Over...
pythondjangoflaskseniorapachesparkjenkins dockerdeveloper

Lead - Observability Integration
Flexi Careers India Pvt Ltd Fresher Chennai 01 Oct, 2025

Primary Responsibilities Observability Integration Engineer Support development teams with OpenTelemetry instrumentation of application code, both zero-code and manual approaches. Assist in con...
monitoring toolsobservability

Capgemini is hiring for Datacom (L3/MPLS) Developer 3 to 8yrs - Chennai
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai 28 Sep, 2025

Were Hiring: Datacom (L3/MPLS) Developer Location:Chennai Experience:6 to 8 Years (focus range) Your Role: Datacom Developer L3/MPLS linux

Senior Gen AI Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Hyderabad 25 Sep, 2025

Permanent job opening for Gen AI Engineer with US MNC organization at Hyderabad Required skills 5 years of professional experience in building Machine Learning models & systems...
machine learningartificial intelligencepythonlanggraphlangchainraggenerative ai

Technical Architect Associate
Chetu India Pvt Ltd Fresher Noida 25 Sep, 2025

Job Summary We are looking for a Technical Architect Associate who will assist in designing, developing, and implementing scalable technology solutions using AI/ML, Python, Java...
intelligencejavascriptpythonjava

Senior Software Engineer 2
C3 India Delivery Centre LLP (formerly known as Crowe Horwath IT Services LLP) Fresher Noida, Uttar Pradesh 25 Sep, 2025

As a Senior Software Engineer II at C3 India Delivery Centre LLP, formerly known as Crowe Horwath IT Services LLP, you will be part of the Audit Transformation practice focusing on research, rapid...
RDBMSAzuremicroservicesAPIsPythonRustpresentation skillsMicrosoft technology stackNET frameworkfrontend developmentJavaScript frameworkNoSQL databasescloud platformserverlessAIML conceptsDevOps toolsAzure AI Foundry

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Lead Data Scientist
Reflections Info Systems Fresher Thiruvananthapuram, Kerala 24 Sep, 2025

As an experienced Lead Data Scientist with a minimum of 8 years of professional experience, including at least 6 years in a data science role, your expertise lies in statistical modeling, machine ...
Statistical ModelingMachine LearningDeep LearningPythonData VisualizationCommunication SkillsComputer VisionPredictive AnalyticsNatural Language ProcessingTime Series AnalysisAPIsAnomaly DetectionGenAIOptimizing CodeData PreprocessingFeatur

Senior Java/Fullstack Developer / Database Architect- KERLA
PRIMATE CONSULTING SERVICES PRIVATE LIMITED Fresher Ernakulam 24 Sep, 2025

Senior Java/Fullstack Developer / Technical Solution & Database Architect Job Summary We are seeking a highly experienced and technically sound Senior Java Developer who can take ownership as a...
javadatabase architecture

Software Engineer, Networking
SHRI BALAJI ENTERPRISES Fresher Kolkata, Mumbai CityMumbai City, Bangalore, Chennai, Indore, Hyderabad, Pune 20 Sep, 2025

We are seeking aPython Engineerwithstrong experience in AWS cloud servicesto join our engineering team. You will design, develop, and deploy scalable back-end sy...
softwaremaintenancetestingnetworkingmainframedevelopmentapplication

.NET Developer
Zine Mind Fresher Kochi, Kerala 20 Sep, 2025

As a suitable candidate for the position, you should possess 5-12 years of experience in software development using .NET Core / ASP .NET with C# & SQL Server. Your hands-on experience in MVC and D...
ASP NETSQL ServerMVCAzureWCF servicesEntity FrameworkWeb ServicesHTMLXMLOOADesign patternsNET CoreDatabase conceptsNtier architecturesDynamic contentSecurity modelsCloud knowledgeWeb APIOOD Concepts

Senior Software Engineer
Fingent Fresher Kochi, Kerala 20 Sep, 2025

You will be a Senior Software Engineer in the .NET domain at Fingent, where we believe in leveraging technology to create a positive impact on the lives of people. Our software solutions are desig...
jQueryEntity FrameworkLINQSQL AzureAppFabricCNETASPNET MVC FrameworkNet CoreAngular 2OOPS conceptsWeb API

Senior Machine Learning Engineer - 2 (Architect)
Adobe Fresher Noida, Uttar Pradesh 20 Sep, 2025

The Adobe Express team is on a mission to create a revolutionary, all-in-one creative application that transcends platforms - be it web, desktop, or mobile. By blending Adobes cutting-edge creativ...
PythonComputer VisionNLPMachine LearningDeep LearningTensorFlowPyTorch

Senior Python & Spark Developer
Best Infosystems Ltd Fresher Mumbai City, Ahmedabad 16 Sep, 2025

Senior Python & Spark Developer_full-time_Ahmedabad & Mumbai Job Title: Senior Python & Spark Developer Experience Required: 5 years Location: Ahmedabad preferred, but open for Mumbai Role Over...
pythondjangoflaskseniorapachesparkjenkins dockerdeveloper

PREV
NEXT

llm architectures Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers