materials manager jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

materials manager Job Openings

Showing 53101 - 53150 of 67769 Jobs

Banking Operations

DIRAA HR SERVICES 0.00 to 4.00 Years Chennai 01 Apr, 2024

opening new accounts

teller operations

Relationship Manager in Housing finance

CAREER TRAKKER 1.00 to 6.00 Years Chennai 01 Apr, 2024

Job description Lead Generation - Identify quality leads from existing customer base /open market by conducting various events andactivities Acquire new Housing Loans (HL) Secured home loan...
home equityhousing developmenthousing loanhome loansmortgage

Priority Client Acqusition(Liabilities)

Acura Solutions Hiring For MNC 3.00 to 8.00 Years Chennai 01 Apr, 2024

Job Title:

Industry:

Qualifications:

Functional Area...
priority bankingliability managementcasa salesclient acquisitionliability salessalesrisk management

Signature Relationship Manager
Acura Solutions Hiring For Leading Bank 3.00 to 7.00 Years Chennai 01 Apr, 2024

Job Title: Signature RM with a Leading Pvt Bank Industry: Banking / NBFC Functional Area: Sales Qualifications Any graduate/...
relationship buildingportfolio managementhni client handlingrelationship managementcross selling

Relationship Manager - Current Account Acquisition
Acura Solutions Hiring For Leading Bank 2.00 to 7.00 Years Chennai 01 Apr, 2024

crossJob Title: Relationship Manager - Current Account Acquisition with a Leading Pvt Bank Industry: Banking Functional Area: Sales Q...
cross sellingcurrent accountrelationship managementrelationship building

Insignia Relationship Manager
Acura Solutions Hiring For Leading Bank 5.00 to 10.00 Years Chennai 01 Apr, 2024

Job Title: Insignia RM with a Leading Pvt Bank Industry: Banking / NBFC Functional Area: Sales Qualifications Any graduate/ ...
wealth managementcross sellinghni client handlinghni acquisitionwealth management servicesrelationship building

Credit Manager
BETTER HIRE 3.00 to 5.00 Years Chennai 01 Apr, 2024

We are looking to hire an experienced credit manager to oversee our company lending process. As a credit manager, you will be responsible for evaluating the creditworthiness of potential ...
trial balanceaccounting consultingcash journalbank statementsstock ledgerperiod end closingclosing entriesaccounting issuesgeneral journal

Backup Branch Manager
Spotlight Recruitment Services 0.00 to 1.00 Years Chennai 01 Apr, 2024

We have an urgent hiring for Back Office/ Backend Executives. Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & above. Language skills: Fluency in English ...
backendback officefront officeoperationsback office operations

Branch Manager
BETTER HIRE 6.00 to 10.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch managementbranch accountingaccounts finalisationbranch operationbranch bankingbranch administration

Branch Head (CASA) - Leading Bank - Chennai & Vijayawada
Response Informatics 3.00 to 4.00 Years Chennai 01 Apr, 2024

Branch Head (CASA) - Leading Bank - Chennai & Vijayawada Experience: 4 years required - CASA Team handling experience must Branch Manager / Branch Head experience required - 3 yrs Industry Pre...
CASATeam handlingBranch Manager

Urgent Hiring - Relationship Manager - High Incentive International Trips
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Chennai 01 Apr, 2024

Greetings from Reliance Nippon Life Insurance! Here is an opportunity to get associated and enhance your career with Indias Top 3 Most Trusted Life Insurance Service Brands by B...
salesrelationship managementbusiness development

Branch Manager
BETTER HIRE 3.00 to 6.00 Years Chennai 01 Apr, 2024

We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tasks are completed successfully in a timely manner. Branch Managers are also responsible ...
branch accountingbranch bankingaccounts finalisationbranch operationsbranch handlingbranch administration

Key Account Manager for Leading NBFC Wealth and Broking Company
Career Shaper Hiring For Leading NBFC/Financial Services Client 1.00 to 6.00 Years Chennai 01 Apr, 2024

SELLING DEMATE AND WEALTH PRODUCTS TO HNI CLIENTS

Acquisition, new customers for wealth and themed products.

Minimum 2 A/Cs of 5 Lac of Initial Margin.

M...
brokingstock tradingsalesdemat accountswealthinsurancemutual fundsstock brokingdemat

Equipment Operator
SUNITA AGRI EXPORTS PRIVATE LIMITED 2.00 to 6.00 Years Chennai 01 Apr, 2024

Equipment Operator Responsibilities:

Ensuring all equipment is maintained and used in accordance with company health and safety regulati...
maintenance improvementequipment maintenancemaintenance engineeringequipment installationequipment

Executive Assistant
MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Chennai 01 Apr, 2024

We are looking for an Executive Assistant to perform a variety of administrative tasks and support our companys senior-level managers. Executive Assistants responsibilities include managing cale...
office equipmentword processingpowerpointcustomer serviceevent planningproject managementconference callsprovides administrative supportexecutive assistant

Branch Operations Manager
BETTER HIRE 6.00 to 7.00 Years Chennai 01 Apr, 2024

A Branch Operations Manager isresponsible for the entire operation of a branch; from ensuring the attainment of sales goals to overseeing everyone provides excellent customer service. Bra...
business planningoperations team handlingoperations managementoperating systemsoperational excellence

Clinical Data Management
TECHNO ENDURA 0.00 to 2.00 Years Chennai 01 Apr, 2024

Clinical Data Management Job Description We are looking for a detail-oriented and organized Clinical Data Manager (CDM) to join our expanding clinical research team. The ideal candidate will be...
clinical data managementelectronic data captureclinical trials

Cardiology Technician
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Chennai 01 Apr, 2024

A cardiology technician is a medical professional whospecializes in diagnosing and treating heart conditions. They typically work in a hospital or clinic, and may be responsible ...
cardiovascular medicinecardiocardiologycardiovascularecgdiagnosticsopdbiomedical

Urgent Opening Cluster Head Admission
A S Group 7.00 to 12.00 Years Bangalore 01 Apr, 2024

A.S. Group is currently hiring for one of the leading International School Management located in Pen India Job Details are as follows:- Designation: Cluster Head Location: Bengaluru Experienc...
admission manageradmission headcluster admission managercluster admission

Vacant Sales Managers For FMCG, Pharma, OTC, Personal care
Adidev Herbals Pvt Ltd 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Required Regional / Area Sales Managers / Business development manager/Sales Executives/ Beauty Parloursales executives to market Herbal, Beauty & Personal care products/Health care products, Ayu...
personal careskin carepharmaceutical salesfmcg channel salesanti-aging productscosmetics

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Estate Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 22.00 Years Bangalore 01 Apr, 2024

Estate Managers are the top-level executive position in a large household or complex of properties that employ a wide array of staff. They are responsible for working directly with the owner to p...
siteassetanalysisconstructionmanagementestateportfoliopropertycustomerdiligenceserviceselectionlandlordsfinancialrealinspections

Administrative Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

We are searching for a perceptive, creative administrative manager to oversee office operations and administrative staff members. The administrative manager will hire, train, and evaluate...
administrative operationsgeneral operationsadministrationadministration workadmin facilities managementgeneral administrationoffice equipmentadministrative supportadministrative assistancemanager

Documentation Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

we are looking for Document Management Specialist, you will play a crucial role in ensuring efficient and organized document management for our organization. You will be responsible for o...
documentationdocumentum administratordocument checkingliasingdocument imagingdocument management systemdocument controlsourcingsourcing management

Safety Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

We are looking for a safety manager with an eye for detail to identify health and safety law violations and create a plan to avoid breaking these laws in the future. The safety manager is...
safety auditsafety auditssafety officer activitiessafety managementsafety implementationsafety engineeringsafetysafety administrationsafety inspection

Overhead Crane
Future Solution Centre 8.00 to 13.00 Years Bangalore 01 Apr, 2024

Overhead cranes are machines used to lift, lower, and move materials horizontally. Structural steel fitters use overhead cranes to position structural steel for welding and fabrication, load and ...
crane operatingcranesoverheads

Engineering Drawings
Future Solution Centre 7.00 to 12.00 Years Bangalore 01 Apr, 2024

Engineering drawings are technical drawings that tell about the requirements for engineering components or equipment. Such drawings have standardized languages and symbols. There are multiple typ...
engineeringdrawing managerengineering change management

Assistant Site Engineer
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job description Overall Planning and Execution of work from receipt of BOQ to Site completion delivering Quality on Time and Within Budget. To turn clients decisions in our Favour & making pr...
project controlproject schedulingproject handlingmonitoringsite initiationsite planningboq preparationcivilbusiness process

TELECOM SITE ENGINEER Saudi Arabia
GLOBAL WINGZ CAREERS Hiring For Engineering company 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title TELECOM SITE ENGINEER Industry of the Employer (only in case of job posting) CIVIL CONSTRUCTION / OIL & GAS Number of Vacancies 25 engineering servicestelecom engineeringmechanical engineering

Site Supervisor & Site Engineer (Civil & Mechanical)
The JSM Engineers 0.00 to 2.00 Years Bangalore 01 Apr, 2024

Job Details

Required Qualification: Dipl/Deg in Mechanical/Civil

Required Location: Hazira, Jamnagar, Pune, Dahej, Bangalore

Required Experience: 0...
siteconstruction safetysite managementsite supervisionsite engineeringcivil engineeringsite executionmechanical engineering

Mechanical Engineer,Civil Engineer, Site Engineer
Sree UGCL Projects Ltd 3.00 to 4.00 Years Bangalore 01 Apr, 2024

Hi Looking for candidates experience in construction or infrastructure filed for our Ramanagar and Magadi projects , worked on gov related projects, road, Pipline, water treatments etc. 10 positi...
pipelinecivil engineering

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

Female Teacher in Delhi Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Ahmedabad 01 Apr, 2024

Objectives of this role

Facilitate a creative and supportive learning environment

Teach important re...
student disciplineteacher trainingthinking maps

Lead - Talent Management
Adani Group 15.00 to 19.00 Years Ahmedabad 01 Apr, 2024

Purpose of the role:- Reporting to the Group Head, Talent and Leadership Development, the Succession Planning & Assessment Leader will be responsible for developing a pipeline of ready-to-deploy,...
Succession PlanningTalent ManagementLeadership DevelopmentOrganizational PsychologyChange ManagementTalent Assessment

Urgent Hiring for Site Engineer
Manpower Solution Fresher Ahmedabad 01 Apr, 2024

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management

Sr. Hardware Engineer
Electrify Services 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Position Title: Hardware Engineer Full Time Electrify Services is one of the fastest-growing engineering services start-ups and is looking for a Sr. Hardware Engineer to play a key role in helpi...
RS485SPIUSBCANZigBeeWiFiGPSGSMWiFiBluetoothSD CardcameraLCDSystem integrationCommunication systemsTeam leadershipHighfrequency electronic circuitsEmbedded hardware products designMixed signal circuit designLowpower circuit designHig

Electronics Hardware Engineer
Multispan Control Instruments 1.00 to 4.00 Years Ahmedabad 01 Apr, 2024

Job Description We are seeking an experienced Electronics Hardware Engineer to join our team. The ideal candidate will have a strong understanding of electronics hardware design and a passion for...
Electronics hardware designAnalogdigital circuit designPrototype testinganalysisComponent sourcingEmbedded systems firmware programmingDevelopment of production test specificationsPreparation of bills of materialsPCB layout

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Graphic Designer
Saathi 2.00 to 4.00 Years Ahmedabad 01 Apr, 2024

As a Graphic Designer at Saathi you will be responsible for the entire process of defining requirements, visualizing and creating graphics including illustrations, photoshops logos, layouts and ...
Analytical SkillsCreativityGraphic Design SoftwareCommunication SkillsPhotoShopIllustratorGraphic Design SkillsLayout SkillsFlexibilityAttention to DetailDeadlineorientedDesktop Publishing ToolsAcute VisionTimemanagement SkillsHandles Reject

Senior Hardware Engineer
Oxit India 7.00 to 11.00 Years Ahmedabad 01 Apr, 2024

Oxit is a pioneering IoT and design service company seeking a Senior Hardware Engineer to enhance our engineering team. This role is essential for client interfacing during technical reviews and d...
Hardware DesignSchematic CaptureLayout DesignAltium DesignerAnalog Circuit DesignDigital Circuit DesignMicrocontrollersPower ManagementBluetoothWiFiZigbeeProject DocumentationIoT TechnologiesRF Communication

Assistant Manager In Banking Sector
TEKPILLAR 1.00 to 3.00 Years Ahmedabad 01 Apr, 2024

Join Our Team as Assistant Manager - Retail Liability Banking Department Are you passionate about driving sales and marketing initiatives in the BFSI domain Were on the lookout...
casasalesbankingfinancebfsifield salesmarketinginsurancelead generetion

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Assistant Manager / Deputy Manager - Internal Audit
UpMan Placements 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

UpMan Placements has an exciting career opportunity with one of our esteemed clients from the Construction industry. Role - Internal Audit Level - Assistant Manager / Deputy Manager Location - ...
Compliance ManagementProject ManagementClient ManagementSite AccountingCostingBudgetingMIS ReviewCost ControlReduction

Assistant Manager - Audit Executive
ADROIT HR Services (Recruitment Agency) 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Responsibilities Support senior auditors in planning and executing statutory audits for diverse clients. Analyze financial statements, investigate irregularities, and prepare audit documentation...
Audit documentationFinancial statements analysisClient collaborationDeadline management

Relationship Manager
Continental HR Services 1.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Here we are hiring in leading housing Finance company. We have opening for RO/RM. Display and market real property to possible buyers. Prepare necessary paperwork.
...
housing financehome loansmortgage loanssalessecuredloan

ON SPOT OFFER- HIGH INCENTIVES -FAST TRACK PROMOTION- INTERNATIONAL TRIPS
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Job Role : Senior Relationship Manager Dear Candidates, Greetings! Roles & Responsibilities,
Candidate has to work on the leads provided by the Organization...
salesbanking saleslife insurancehealth insuranceunit manager

Manager Sales - Aditya Birla Sun Life Insurance Co
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Dear Sir/Madam, We are pleased to let you know; your profile has been shortlisted by our HR team for Manager positions in our sales team. Interviews are currently ongoing in your locations. If...
life insurancesales

Sales Manager
RS Business Support Services 1.00 to 6.00 Years Vishakhapatnam 30 Mar, 2024

Greetings from RSBSS! Position: Sales manager (Home loans) Candidate must have home loan sales experience Job description salesdisbursementhome loanslapopen market

Dy. Manager - Channel Sales
Bluecrest HR Consulting Private Limited 4.00 to 9.00 Years Vishakhapatnam 30 Mar, 2024

Post: Dy. Manager - Channel Sales Reports to : Regional Sales Head Channel Management Education : Diploma / Bachelor of Engineering / Tech (Chemicals/M...
chemical salesequipment salescustomer relationshipindustrial saleschannel salessales process

Data Entry Operator, Work From Home, Part Time
LAXMI TECHNOLOGY 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Greetings, We AreGovt. Reg. AndGenuine Data Entry service provider, In All over India. For more details Contact Our Project Manager90hidden_mobil...
excelfreelance writingwork from home typingdata entry operationfreelance typingmanualfreelance editing

PREV
NEXT

materials manager Job Openings

Job description Lead Generation - Identify quality leads from existing customer base /open market by conducting various events andactivities Acquire new Housing Loans (HL) Secured home loan... home equityhousing developmenthousing loanhome loansmortgage

Equipment Operator Responsibilities:

Objectives of this role

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi... construction site managementsite executionsite supervisionsite coordinationsite management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Lead Generation - Identify quality leads from existing customer base /open market by conducting various events andactivities Acquire new Housing Loans (HL) Secured home loan...
home equityhousing developmenthousing loanhome loansmortgage

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management