Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Key skills required for the job are: n MS SCCM Admin - System Center Configuration Manager-L3, (Mandatory) .As a Senior Developer, you are responsible for development, support, maintenance and impleme...
configuration managementjenkinsreportingbasissystem centersoftware developmentsccmsoftwaremaintenanceimplementationOpalisSCDPMVirtual Machine ManagerSCSMMDOPSystem Center Virtual Machine ManagerKey skills required for the job are: MS SCCM Admin - System Center Configuration Manager-L3 (Mandatory) As a Consultant, you should have in-depth knowledge in any one technological or industry practic...
configuration managementjenkinsreportingbasissystem centersccmconsultingOpalisSCDPMVirtual Machine ManagerSCSMMDOPKey skills required for the job are: n MS SCCM Admin - System Center Configuration Manager-L2, (Mandatory) .As a Lead, you are responsible for managing a small team of analysts, developers, testers or...
configuration managementjenkinsreportingbasissystem centerproject administrationsccmtestersanalystsengineersOpalisSCDPMVirtual Machine ManagerSCSMMDOPSystem Center Virtual Machine ManagerWindows Intune
Key skills required for the job are: n MDM - Intune-L3,MS SCCM Admin - System Center Configuration Manager-L3, (Mandatory) .As a Lead, you are responsible for managing a small team of analysts, develo...
configuration managementjenkinsreportingbasissystem centerproject administrationmdmsccmtestersanalystsOpalisSCDPMVirtual Machine ManagerSCSMMDOPSystem Center Virtual Machine ManagerResponsibilities 1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Co...
group policydnsfirewallsqlwindow server1. Hardware and Networking-Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD-Knowledge of AD Roles, Global Catalog Server, ...
direct accessdartmapvdidesktopvendorshardwareaccessmdopnativedata backupgroup policywinlockersfeaturesviruswindows 7windowsmedv1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Configuring the VPN connection and giving permission f...
server administrationfirewall
Key skills required for the job are:
Job Description Minimum of 5 years of experience in analyzing Microsoft Windows and SCCM related issues Hands on experience in resolving OSD and HW driver installation issues Strong know how in app...
applicationservices financialservices plsql sql sql windows presentation installation communication USMT MDOP OSMigration ADK WinPE WAIK EDVKey skills required for the job are: n SCCM Admin - System Center Configuration Manager-L3, (Mandatory) . As a Consultant, you should have in-depth knowledge in any one technological or industry prac...
configuration managementjenkins reporting basisSCDPM Virtual Machine ManagerSCSM MDOPDesignation: System Administrator or Sr. System Administrator SCCM Domain : Enterprise Infrastructure Virtualization Engineering Department: End User Technology Site : Hyderabad, R1RCM Global ...
windows servermicrosoft sql patch managementit hardware system deploymentsoftware distribution audio masteringtroubleshootingWalk-in interviews for OSD Production and Packing operators. Department : Production Area : Granulation, Compression, Coating, Capsule filling. Designation : Operator. Experience...
validation english production hindi msoffice osd coating packing granulation compression designation USMT MDOP OSMigration ADK WinPE WAIK SCUP ImageX EDVSystem Admin 1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Configuring the VPN connection and giving p...
dnsservermailserverfileservermusicmakingcustomerservicedisasterrecoveryidentifyingissuessqlerpdnsvpnftpnatdhcpcaremailmdopctivedirectinventymanagementservicesupp1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescriptsGood knowledge of SCCM product suites (SCCM Administrator Console, Remote tools, Software Distribution, Inventory, Software Metering, SCCM Server components and Operating System Deployment, MDT 2010, ...
windowsserveradministrationprintserverswindowsserverpatchmanagementbuildmanagementsystemdeploymentapplicationpackagingserveradministrationsoftwaredistributionmicrosoftsqlervicesupp1. Hardware and Networking - Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD - Knowledge of AD Roles, Global Catalog Se...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescriptsor 3rd party encryptions as per customer requirement, Direct Access etc.Good working knowledge of Windows 7 deployment Process creation. 4. Direct access & Branch Cache- Working knowledge of Deploy...
vdidartcacheviruswindowsdesktopantivirusmapusmtmdopaccessnativescriptshardware1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts1. Hardware and Networking- Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD- Knowledge of AD Roles, Global Catalog Serv...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts1. Hardware and Networking - Knowledge on Desktop Hardware - Multiple Vendors, Remote Management Tools, knowledge on network fundamentals & topology 2. AD - Knowledge of AD Roles, Global Catalog Se...
vdidartcacheviruswindowsdesktopwinmapusmtmdopaccessnativescripts© 2019 Hireejobs All Rights Reserved