Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
* Should have experience to deal with end users , third party vendors and global IT Team. Hands on Experience on Windows server 2016 , Vmware , VSAN , V-Center , storage technology and Hybrid IT Inf...
it infrastructurefile serverhybrid cloudthird party vendorssecurity controlswindows serverpatch managementResponsibilities 1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Co...
group policydnsfirewallsqlwindow server1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Configuring the VPN connection and giving permission f...
server administrationfirewallAbout Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operations, w...
storage area networkfile serververitas netbackupservice managementperformance tuningnegotiation skillsmanagement systemsproblem resolutionstorage area network sanKPI Monitoring Task - Core Engineer Experience Required: Plans and executes technical tasks according to given tasks, along with existing processes and instructions. Works with the responsibility of r...
gsm troubleshooting 3g mss it 4g cms networking scalationprocess hpblade presentationskills kpimonitoring performanceanalysis fileserver networkperformance corenetworkPosition: Infrastructure Experience: 3 to 5 yrs No of Positions: 1 Qualification: Any Degree Mandatory: 1. Designing Infrastructure requirement and Implementation 2. Installation & Configuration of ne...
datacenter fileserver loganalysis loadbalancing securityaudit clientmeeting backupmanagement applicationservers documentpreparation optimizationstrategies databackup it sql iis erf mancemonit ingL2 Engineer Server Level Support No. of Positions: 4 5 Department: Technical Location: Pune Educational qualifications: Graduate/ MBA/ B.E (Knowledge in IT Field) Experience: 3 5 years (Relevant ...
troubleshooting dns dhcp fileserver grouppolicy printserver windowsserver windowsadministration it mis iis san wsus linux trust print echnicalsupp activedirect netw kdevices st agemanagementL2 Engineer Server Level Support No. of Positions: 4 5 Department: Technical Location: Mumbai Educational qualifications: Graduate/ MBA/ B.E (Knowledge in IT Field) Experience: 3 5 years (Relevan...
troubleshooting dns dhcp fileserver grouppolicy printserver windowsserver windowsadministration it mis iis san wsus linux trust print echnicalsupp activedirect netw kdevices st agemanagementL2 - System Engineer Designation: L2 Engineer Server Level Support No. of Positions: 4 5 Department: Technical Location: Bangalore Educational qualifications: Graduate/ MBA/ B.E (Knowledge in IT...
troubleshooting dns dhcp fileserver grouppolicy printserver windowsserver windowsadministration it mis iis san wsus linux trust print echnicalsupp activedirect netw kdevices st agemanagementKPI Monitoring Task - Core Engineer Experience Required: Plans and executes technical tasks according to given tasks, along with existing processes and instructions. Works with the responsibility of r...
gsm troubleshooting 3g mss it 4g cms networking scalationprocess hpblade presentationskills kpimonitoring performanceanalysis fileserver networkperformance corenetworkServer Administrator Job location: Mumbai Experience: 2 years Number of Positions: 01 Candidate should have knowledge of Managing Networks, Server Installation and Maintenance, Host websites on server...
dhcp windows dns linux lotusnotes webhosting mailserver fileserver linuxserver printserver remotecontrol securitysystems patchmanagement monit antivirusserver ctivedirect ingtools technicalsuWe are looking for a System Engineer with strong technical and troubleshooting skills to be able to implement server solutions to our enterprise customers. Job Responsibilities: Windows Server Install...
deliveryproject management customer relationsreporting javastrong communication skills windows server administrationweb serverKPI Monitoring Task - Core Engineer Experience Required: Plans and executes technical tasks according to given tasks, along with existing processes and instructions. Works with the responsibility of r...
gsm troubleshooting 3g mss it 4g cms networking scalationprocess hpblade presentationskills kpimonitoring performanceanalysis fileserver networkperformance corenetwork
REQUIREMENTS :
Position: Infrastructure Experience: 3 to 5 yrs No of Positions: 1 Qualification: Any Degree Mandatory: 1. Designing Infrastructure requirement and Implementation 2. Installation & Configuration of ne...
datacenter fileserver loganalysis loadbalancing securityaudit clientmeeting backupmanagement applicationservers documentpreparation optimizationstrategies databackup it sql iis erf mancemonit ingGood PeopleSoft admin experience. Experience in PeopleTools 8.56/8.57 Scripting experience for automation and strong debugging skills Exposure to cloud (IAAS/PAAS) and automation Exposure to Puppet/Ru...
environment windows microsoftsqlserver oraclevm weblogic sqlserver posting fileserver webservers iversityinclusion
REQUIREMENTS :
Server Administrator Job location: Mumbai Experience: 2 years Number of Positions: 01 Candidate should have knowledge of Managing Networks, Server Installation and Maintenance, Host websites on server...
dhcp windows dns linux lotusnotes webhosting mailserver fileserver linuxserver printserver remotecontrol securitysystems patchmanagement monit antivirusserver ctivedirect ingtools technicalsuJob description Senior Advisor IT Infrastructure. Technical Skills Senior Advisor IT Infra position requires immense knowledge and good experience in Dell Server Platform, VMware and ...
microsoft platformhardware infrastructure emcdns drsdhcp esxivisio vmwarewindowsJob description Advisor IT Infrastructure. Technical Skills Advisor IT Infra position requires immense knowledge and good experience in Dell Server Platform, VMware and Microsoft oper...
file servermicrosoft platform written communicationhardware infrastructure emcdns drsdhcpL2 Engineer Server Level Support No. of Positions: 4 5 Department: Technical Location: Pune Educational qualifications: Graduate/ MBA/ B.E (Knowledge in IT Field) Experience: 3 5 years (Relevant ...
troubleshooting dns dhcp fileserver grouppolicy printserver windowsserver windowsadministration it mis iis san wsus linux trust print echnicalsupp activedirect netw kdevices st agemanagementL2 Engineer Server Level Support No. of Positions: 4 5 Department: Technical Location: Mumbai Educational qualifications: Graduate/ MBA/ B.E (Knowledge in IT Field) Experience: 3 5 years (Relevan...
troubleshooting dns dhcp fileserver grouppolicy printserver windowsserver windowsadministration it mis iis san wsus linux trust print echnicalsupp activedirect netw kdevices st agemanagementPosition: Infrastructure Experience: 3 to 5 yrs No of Positions: 1 Qualification: Any Degree Mandatory: 1. Designing Infrastructure requirement and Implementation 2. Installation & Configuration of ne...
datacenter fileserver loganalysis loadbalancing securityaudit clientmeeting backupmanagement applicationservers documentpreparation optimizationstrategies databackup it sql iis erf mancemonit ing
Hello , we have the requirement of Window administrator for Kolkata Minimum graduation with 50% and above JD : Active Directory (AD) ADMIN. Managed User Accounts/Computer /Group/...
dhcp activedirectory windowsserver windows troubleshooting fileserver grouppolicy printserver optimizationstrategies ps os dns epo sccm print mcafee window objects helpdesk yperv
Install , configure and administer Windows Server 2003 / 2008 / 2012 , Vista , Win 7 / 8 / 10 and Linux - Administration , monitoring , and troubleshooting of Local Area network (LAN) for optimal pe...
troubleshooting lan operatingsystems switches sqlserver trendmicro fileserver grouppolicy healthcheck musicmaking windowsserver mcafeeantivirus videoconference etw king localareanetw testenvironRoles and responsibilities Certification should be CCNA or RHCE (Preferred) Installation and configuration of domain controller on active directory services. Creating and troubleshooting FTP...
cisco wan firewall routing troubleshooting serverconfiguration net ftp ccna rhce vlan ebserver fileserver webservers proxyserver terminalserver activedirect routingprotocols domaincontroller vtpMain responsibilities and key activities: o Responsible for the daily user-support, including: o Work on Disk, Memory, Processor incidents and Patch the Servers. o Deploy Firmware updates, Service Pac...
windowsserver troubleshooting servers breakfix fileserver systemcenter projectplans knowledgebase tsupp supp tsystemsThe infrastructure running industries likes transportation, energy, insurance, banking or healthcare is quickly changing as the world s relationship with technology evolves. Companies have more choice...
fileserver windowsserver userexperience globaldelivery timemanagement designthinking creativedesign audiomastering equipmentsupply capacityplanning operatingsystems desktopmanagement upp tservicesThe infrastructure running industries likes transportation, energy, insurance, banking or healthcare is quickly changing as the world s relationship with technology evolves. Companies have more choice...
fileserver windowsserver userexperience globaldelivery timemanagement designthinking creativedesign audiomastering equipmentsupply capacityplanning operatingsystems desktopmanagement upp tservicesThe infrastructure running industries likes transportation, energy, insurance, banking or healthcare is quickly changing as the world s relationship with technology evolves. Companies have more choice...
fileserver windowsserver userexperience globaldelivery timemanagement designthinking creativedesign audiomastering equipmentsupply capacityplanning operatingsystems desktopmanagement upp tservicesThe infrastructure running industries likes transportation, energy, insurance, banking or healthcare is quickly changing as the world s relationship with technology evolves. Companies have more choice...
fileserver windowsserver userexperience globaldelivery timemanagement designthinking creativedesign audiomastering equipmentsupply capacityplanning operatingsystems desktopmanagement upp tservicesPosition: Desktop Support (1 - 3 yrs) Location: Mumbai, India Technical Skills: Installation of Operating System Win XP, Win 7, Win 8, Win Server 2008, Ubuntu, Debian Troubleshooting & Maintenance...
opensourcesoftware opensource fileserver openoffice faultfinding ipaddressing devicedrivers microsoftoutlook it ip xp lan isp wan vpn tcp pcs esktopsupp netw kdevices netw kmonit ingPosition: Infrastructure Experience: 3 to 5 yrs No of Positions: 1 Qualification: Any Degree Mandatory: 1. Designing Infrastructure requirement and Implementation 2. Installation & Configuration of ne...
datacenterfileserverloganalysisloadbalancingsecurityauditclientmeetingbackupmanagementapplicationserversdocumentpreparationoptimizationstrategiesdatabackupsqliiserfmancemonitingSystem Admin 1. Firewall: a) Configuring the Firewall Access Rules, NAT polices, Creating Address Objective, taking backup of the Firewall and restoring. b) Configuring the VPN connection and giving p...
dnsservermailserverfileservermusicmakingcustomerservicedisasterrecoveryidentifyingissuessqlerpdnsvpnftpnatdhcpcaremailmdopctivedirectinventymanagementservicesupp"
As a member of the Support organization, your focus is to deliver post-sales support and solutions to the Oracle customer base while serving as an advocate for customer needs. This involves resolving ...
ciscoroutingbgptroubleshootingswitcheslinuxsystemadministrationenvironmentalimpactassessmentdatacenterfileserverlowercostscustomerdataremotedesktopcledatabaseadministrationremotesuppAs a member of the Support organization, your focus is to deliver post-sales support and solutions to the Oracle customer base while serving as an advocate for customer needs. This involves resolving ...
databasessqlserversqltuningenvironmentalimpactassessmentfileserverlowercostscustomerdataremotedesktopciscoswitchescleracaclegridremotesuppdercontrolacledatabaseJob Title: System administrator Job Location: Baner, Pune Experience: 3-6 Years Qualification: UG - BSC, BCS, BE, BCA, Post Graduate: MCS, MCA, MSC (Masters in Compu...
troubleshootingwindowsdhcploadbalancingdisasterrecoveryetwkingactivedirectfileserverexchangeserverwindowsfirewallmissioncriticalservermanagementcomputersecurityintrusiondetectionuseradPrimary Responsibilities IT operations and continual service improvement manager. Administration of Information Security Management System. Windows Server Administration - AD, File Server, DHCP, W...
salesmisaccountstatbankingwindowsserveradministrationmsofficeitoperationswindowsserverproblemsolvingassetmanagementmationsecuritymanagementfileserverciscoswitchesbackupmanagementcontMust be CCNA certified & having the knowledge CCNP & CCSP. LAN, WAN, Wifi, MPLS OSI Layers, Crimping, Aware of Network Topology/Diagram Configuration & Managing of Cisco Switches (L2 & L3), Routers...
ciscowindowsnetworkingprotocolslandevicesiostroubleshootingroutersmailsqlroutingsecurityswitchesortnetworkcoordinationvendorwindows8server© 2019 Hireejobs All Rights Reserved