Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Responsibilities & Key Deliverables 1. Develop finite element modelling of Engine and Transmission components and Systems, by understanding and adhering to element and part qua...
safetycommissioningsiteinspectiontroubleshootingcrank shaftquality checkreport writingwriting skillsresponse analysismaterial propertiesResponsibilities & Key Deliverables 1. Develop finite element modelling of Engine and Transmission components and Systems, by understanding and adhering to element and part qua...
siteinspectiontroubleshootingcrank shaftquality checkreport writingwriting skillsresponse analysismaterial propertiesExperience : 2-5 years Skill Set: CAE Durability Analysis: 1) Excellent knowledge of the Finite Element Method (FEM). 2) Experience in at least 2 complete vehicle durability simulation projects. 3...
test dataabaqustestingnastransoftwarecommercialsimulationdurabilityTest EnvironmentsTest RequirementsTest CoverageTest Environment SetupData MaskingTest MetricsTest ScenariosTest DesigningTest SpecificationNVHRadiosscae
Cyient is a global engineering and technology solutions company. As a Design, Build, and Maintain partner for leading organizations worldwide, we take solution ownership across the value chain to help...
modal analysisfinite element analysisadvanced analyticsstatic analysismachine designfem analysisaero enginecomplex analysistechnology solutionssolid mechanicsmechanical engineeringnonlinear analysis
Sr Engineer_Durability Essential: Good Knowledge in Engineering Fundamentals
Sr Engineer_Durability Essential: Good Knowledge in Engineering Fundamentals
Sr Engineer_Durability Essential: Good Knowledge in Engineering Fundamentals
Sr Engineer_Durability Essential: Good Knowledge in Engineering Fundamentals
Sr Engineer_Durability Essential: Good Knowledge in Engineering Fundamentals
* Seat Comfort simulations: Finite Element Analysis using Abaqus Standard on Automotive Seating systems Expected skills: - Meshing using HM and/or ANSA - Simulation expereince using Abaqus Standar...
finite element analysismechanical engineeringabaqusseatingmeshinganalysisanimationhyperviewmechanicalautomotivesimulationengineeringFatigue AnalysisStress AnalysisNastranComputational Mechanicscae* Human Body Modeling: Finite Element Analysis using Ls-Dyna or equivalent explicit codes Building Human Body Models and perform Crash simulations Expected skills: - Meshing using HM and/or ANSA...
finite element analysiscommercial modelslsdynameshinganalysisanimationhyperviewmechanicalsimulationFatigue AnalysisStress AnalysisNastranComputational MechanicsJob Title : Fresher/ Trainee FEA Engineer Qualification : Bachelor/ Masters in Mechanical/ Automobile/ Production Engineering Experience : 0- 6 Months Pre- requisite : Thorough knowledge about engin...
ansysfeamechanicalmodal analysisstatic analysisdesignengineeringFatigue AnalysisStress AnalysisNastranComputational MechanicsLSDYNAStructural DynamicsMSC PatranSolid MechanicsHypermeshDesign Firms Responsibilities:
Manage a team of 5 members and responsible for their throughput
Responsible for Planning, Coordination, Monitoring & Status reporting
Responsible for...
SKILLS REQUIRED Good Knowledge in NVH basics Able to interpret the analysis results and find the root cause Should have vehicle level NVH analysis using Adams. Hands on experience in vehicle NVH ...
caenvhodsnastranmechanicaloptistructmapidlerootroadadamsanalysiscae toolsinterpretautomotiveCAE Modeler RLE India is seeking a CAE Modeler. This position will be located at Automotive OEM Based out in Chennai Experience Required 1- 2 yrs Open Positions 8 Qualification Diploma/ B. E (Mech/...
caefeaoemnvhcomfilmdynabasichttpsdesignabaqussetvideobrandCAE Analyst (Vehicle Dynamics) RLE India is seeking a CAE Analyst (Vehicle Dynamics) . This position will be located at Automotive OEM Based out in Chennai Position CAE Analyst Experience Required 5...
caeoemnvhcomodsfilmansabasicmapsetidlerootroadvideobrandSenior CAE Modeler RLE India is seeking a Senior CAE Modeler. This position will be located at Automotive OEM Based out in Chennai. Experience Required 2- 4 yrs Open Positions 2 Qualification Diplo...
caefeaoemnvhcomfilmdynabasichttpsdesignsetvideobrandtrimsA Transformer Manufacturing Company in Jaipur is looking for Auto Cad- Draughtsmen: Transformer Design: Only candidates from Transformer industry required ...
transformercaddesignmechanicaldraftingelectrical.automechanical drafting of transformerscad utilities/design2d/3d modelling3ds max vault basicfusion 360FEA Engineer - Bengaluru & Hyderabad - Cadmaxx:Cadmaxx: INFO/EVENT LINKS FEA Engineer Bengaluru Hyderabad Position : FEA Engineer Experience : 2 to 7 years Skills : Hypermesh, Nastran, Patran, Aero...
ansysfeamechanicalmodal analysisstatic analysisfinite element analysisaero enginemachine designstress analysissolid mechanicsfatigue analysismechanical engineeringcaddrawapdlsounddesignpatrannastrannonlinear analysisA Transformer Manufacturing Company in Jaipur is looking for Auto Cad- Draughtsmen: Transformer Design: Only candidates from Transformer industry required ...
designcadtransformerdraftingmanufacturing3ds max vault basicfusion 360automechanical drafting of transformers2d/3d modellingcad utilities/designauto cad nastran- in cadGender : Any Industry : Pneumatics Hydraulics Candidate should be master in CATIA Software with Automation / SPM/Fixture designing experience. Should be having knowledge of Pneumatics Hydraulics etc. ...
drawingautocaddraftingmodelingcadcatiasoftwareautomationhydraulicspneumaticsVPMENOVIA LCADELMIAMatrixOneMSC PatranENOVIA SmarTeamNastranSmarTeamJOB PURPOSE: To serve as an experienced, individual contributor on projects and assignments that are complex in nature and that support and enhance Caterpillar product performance, durability, ...
plcautomationscadasalesprogrammingstructural health monitoringcomputational fluid dynamicsbig datamachine designfluid dynamicscustomer focusneeds analysisbusiness unitscomplex analysisanalytical skillsResearch and author textbooks on latest CAD/ CAM/ CAE packages like Creo, SolidWorks, Solid Edge, NX, CATIA, Inventor, AutoCAD, Hypermesh, ANSYS, COSMOS, NASTRAN, SolidCAM, etc. Provide technical sup...
cad camautocadug nxsolidworksautodesk inventorcaehypermeshansyscatiacreo Responsibilities:
Manage a team of 5 members and responsible for their throughput
Responsible for Planning, Coordination, Monitoring & Status reporting
Responsible for...
* As Performance/Simulation/Application Engineer/Sr. Engineer you will serve as an individual contributor on projects and assignments that are complex in nature and that support and enhance Caterpill...
safetycommissioningsiteinspectiondata structuresversion controlsoftware testingsoftware qualitycomputer operatingproduct developmentsimulation softwaresoftware developmentmultibody dynamicsJob Title : Fresher/ Trainee FEA Engineer Qualification : Bachelor/ Masters in Mechanical/ Automobile/ Production Engineering Experience : 0- 6 Months Pre- requisite : Thorough knowledge about engin...
ansysfeamechanicalmodal analysisstatic analysisdesignengineeringFatigue AnalysisStress AnalysisNastranComputational MechanicsLSDYNAStructural DynamicsMSC PatranSolid MechanicsHypermeshDesign FirmsPosition: Sr. Sales Engineers Location: Bangalore, New Delhi, Chennai and Hyderabad Sales engineers with an experience of 3-5 years in Software Sales, preferably in CAD/ CAM/ CAE/ PLM software in ...
salesmarketingnegotiationbusiness developmentcustomer relationsmsc nastransoftware salesequipment salescommunication skillsplmcmmscatiaansysidealabacussellingnastransoftware
Description
- Should have good experience in Abaqus, Nastran, Hypermesh.
- Should have good analysis experience in Automotive domain in dynamic analysis.
A leading company in Pune is looking for Crash Analyst on urgent basis.
Qualification: BE, MTech Mechanical/Automotive
Experience Min 4 years in Automotive
Job type Full ti...
cad camcadcamdynakneefmvsssalarynastransoftwareanalysishypermeshmechanicalautomotiveregulationsSolid ModelingDesign EngineeringSheet MetalSteel DetailingcaePDMCyient is one of the worlds leading rail engineering solutions partner repeatedly trusted by rail majors to address complex engineering challenges across the design-build-maintain life cycle. Our Desi...
stress analysisnastranhypermeshpatrancatiaroot causemsc nastranpower plantsrolling stockheat transferfluid dynamicsthermal analysisproduct engineering
A leading company in Pune is looking for Crash Analyst on urgent basis.
Qualification: BE, MTech Mechanical/Automotive
Experience Min 4 years in Automotive
Job type Full ti...
cad camcadcamdynakneefmvsssalarynastransoftwareanalysishypermeshmechanicalautomotiveregulationsSolid ModelingDesign EngineeringSheet MetalSteel DetailingcaePDMFinite element modeling and analysis using ANSYS or NASTRAN. Candidates should have hands- on experience with various analysis types such as linear statics, nonlinear statics (contact, material and la...
ansyscustomer relationssafetyaptrandom vibrationheavy engineeringcommercial modelsharmonic analysisvibration analysisfeastaticsanalysisdynamicshypermeshansys wkbenchanalysis repkbenchAircraft structures, preferably in any one of the following areas: Analysis of Primary & Secondary (Fuselage, Wing and Empennage) structures Knowledge and hands- on experience in Stress analysis (...
stress analysisdamage tolerancetolerance analysisaircraft structuresvbaoemexcelabaqusnastranmathcadanalysisstructuresDamage ToleranceFatigue AnalysisMSC PatranCAESAR IINastranAutoPIPEFEMAPNASGROJob Title : Fresher/ Trainee FEA Engineer Qualification : Bachelor/ Masters in Mechanical/ Automobile/ Production Engineering Experience : 0- 6 Months Pre- requisite : Thorough knowledge about engin...
ansysfeamechanicalmodal analysisstatic analysisdesignengineeringFatigue AnalysisStress AnalysisNastranComputational MechanicsLSDYNAStructural DynamicsMSC PatranSolid MechanicsHypermeshDesign FirmsLocation: 1 for Bangalore , 1 for Hyderabad , 1 for Chennai Sales engineers with an experience of 1 - 2 years handling sales of CAD / CAM / CAE / PLM software in above listed location , with BE / Di...
salesmarketingnegotiationbusiness developmentcustomer relationsmsc nastrancadcaeplmcamcatiaansysidealabacussellingnastransoftwareanalysishypermeshResearch and author textbooks on latest CAD/ CAM/ CAE packages like Creo, SolidWorks, Solid Edge, NX, CATIA, Inventor, AutoCAD, Hypermesh, ANSYS, COSMOS, NASTRAN, SolidCAM, etc. Provide technical sup...
cad camautocadug nxsolidworksautodesk inventorcaehypermeshansyscatiacreoGender : Any Industry : Pneumatics Hydraulics Candidate should be master in CATIA Software with Automation / SPM/Fixture designing experience. Should be having knowledge of Pneumatics Hydraulics etc. ...
drawingautocaddraftingmodelingcadcatiasoftwareautomationhydraulicspneumaticsVPMENOVIA LCADELMIAMatrixOneMSC PatranENOVIA SmarTeamNastranSmarTeamPosition: Sr. Sales Engineers Location: Bangalore, New Delhi, Chennai and Hyderabad Sales engineers with an experience of 3-5 years in Software Sales, preferably in CAD/ CAM/ CAE/ PLM software in ...
salesmarketingnegotiationbusiness developmentcustomer relationsmsc nastransoftware salesequipment salescommunication skillsplmcmmscatiaansysidealabacussellingnastransoftwareAircraft structures, preferably in any one of the following areas: Analysis of Primary & Secondary (Fuselage, Wing and Empennage) structures Knowledge and hands- on experience in Stress analysis (...
stress analysisdamage tolerancetolerance analysisaircraft structuresvbaoemexcelabaqusnastranmathcadanalysisstructuresDamage ToleranceFatigue AnalysisMSC PatranCAESAR IINastranAutoPIPEFEMAPNASGROFinite element modeling and analysis using ANSYS or NASTRAN. Candidates should have hands- on experience with various analysis types such as linear statics, nonlinear statics (contact, material and la...
ansyscustomer relationssafetyaptrandom vibrationheavy engineeringcommercial modelsharmonic analysisvibration analysisfeastaticsanalysisdynamicshypermeshansys wkbenchanalysis repkbenchFEA Engineer - Bengaluru & Hyderabad - Cadmaxx:Cadmaxx: INFO/EVENT LINKS FEA Engineer Bengaluru Hyderabad Position : FEA Engineer Experience : 2 to 7 years Skills : Hypermesh, Nastran, Patran, Aero...
ansysfeamechanicalmodal analysisstatic analysisfinite element analysisaero enginemachine designstress analysissolid mechanicsfatigue analysismechanical engineeringcaddrawapdlsounddesignpatrannastrannonlinear analysisFEA Engineer - Bengaluru & Hyderabad - Cadmaxx:Cadmaxx: INFO/EVENT LINKS FEA Engineer Bengaluru Hyderabad Position : FEA Engineer Experience : 2 to 7 years Skills : Hypermesh, Nastran, Patran, Aero...
ansysfeamechanicalmodal analysisstatic analysisfinite element analysisaero enginemachine designstress analysissolid mechanicsfatigue analysismechanical engineeringcaddrawapdlsounddesignpatrannastrannonlinear analysis
A leading company in Pune is looking for Crash Analyst on urgent basis.
Qualification: BE, MTech Mechanical/Automotive
Experience Min 4 years in Automotive
Job type Full ti...
cad camcadcaecamdynakneefmvsssalarynastransoftwareanalysishypermeshmechanicalautomotiveregulationsSolid ModelingDesign EngineeringSheet MetalSteel DetailingPDM
Experience 3 - 5 years
Qualification BE
Job type Onsite
Job requirements
1. Candidate should have 3 5 years of experience, Seating system FEA experience would b...
hypermeshansysnastrancaeoptistructcad camcadfeacamsbadynatestingseatingluggagemeshingsoftwareanalysisUV MappingSpecialization: Analysis Experience: 2 to 3 years of experience in Analysis work and software Tool experience: Ansys, Nastran 1. Providing product demonstrations to customers in various industry ve...
cvssalesansysnastransoftwarepresalesengineeringwinfemapdealsproofbusinessanalysisautomotivecase studies© 2019 Hireejobs All Rights Reserved