Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Date:07-Sep-2021 Location:Pune, India Company:Tata Communications
Roles and Responsibilities Primary Skills At least 5 years of experience with Linux, Jenkins, Bash, Docker, Kubernetes, GIT, Open shift container platform(OCP), AWS, Azure Cl...
awsjenkinslinuxbashazuregitmicrosoft azuredockersecurityautomationwork effectivelyvirtual machinesocpmavenverbal communicationrubysounddevopsansiblecloudAbout Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
javajavascriptsqlcustomer relationshtmldisk managementbusiness processanalytical skillsvpn configurationpresentation skillsagile methodologiessoftware engineeringTelco Architect
About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skills ac...
change managementcleaningjavasqlaccountsdisk managementanalytical skillsvpn configurationpresentation skillsagile methodologiessoftware engineering
Hewlett Packard Enterprise is an industry leading Technology Company that enables customers to go further, faster. With the industry s most comprehensive portfolio, spanning the cloud to the data cent...
troubleshootingdata centeractive directorydhcpdirect accessnetworkingwindowshp serversopen sourceproblem solvingweb serverit servicesknowledge baseroot causeimpact analysiscomputer science
Job level: Sr. Service Desk Analyst (Level 2) You: Apptio is currently looking for a Sr. Service Desk Analyst Level 2 with a passion for customer service and experi...
troubleshootingservice deskslaactive directory administrationactive directorypc hardwareroot causeit operationsit service deskos xmac os xtechnical supportwindows 7mac oscustomer relationsJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Experience L2/ l3 Protocol Testing and networking concepts: VLANs, OpenVPN, ipt...
protocol testingphpcmshtmlperlrubyvlanmysqlpythondesigntestingopenvpniptablesscriptingjavascriptl3 protocol testingprotocolnetwkingJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Exp. on L2/ L3 protocols development in C/ C - 802.1Q, GRE, VXLAN, L2VPN, MPLS,...
six sigmams officecloud computingpmpsanbgpgrejavaitilsfdcitsmmplsvlanavayacloudl2vpnisisdesignl3 protocolsMandatory Skills Application onboarding & Integration Networking & Routing (DNS Names) Certs Management Capacity Planning Splunk, Cymatics, Whisper, Proxy etc. Application Infrastructure & Security Pr...
poundroutingrolloutconsultingmonitoringonboardinginfrastructureMuninGlusterFSVarnishDovecotSquidOpenVPNCactiProxyBindSwitchingBorder Gateway ProtocolJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Exp. on L2/ L3 protocols development in C/ C - 802.1Q, GRE, VXLAN, L2VPN, MPLS,...
six sigmams officecloud computingpmpsanbgpgrejavaitilsfdcitsmmplsvlanavayacloudl2vpnisisdesignl3 protocolsJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Experience L2/ l3 Protocol Testing and networking concepts: VLANs, OpenVPN, ipt...
protocol testingphpcmshtmlperlrubyvlanmysqlpythondesigntestingopenvpniptablesscriptingjavascriptl3 protocol testingprotocolnetwkingExperience working with business users to gather requirements and translate to technical specs. Experience with agile/scrumban based software development and automation engineering. (Azure DevOps / J...
business process automationit servicesdata servicescomputer sciencebuild automationbusiness processleadership skillsprocess automationsoftware developmentprogramming languagesconfiguration managementJob And Resposibilties: - Build, Monitor and maintaining servers. Hosting Websites and creating domain on dedicated servers. Taking periodic backup from server and maintaining records. Worksta...
lanwandnsvpngreunixdhcplinuxmysqlipsecapachewindowsfreebsdexceltunnelsUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gresqlbashdhcpospfdnsvpnwanvlanlaniisperlunixUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gre sql bash dhcp ospf dns vpn wan vlan lan iis perl unix hpProject Manager / Program Manager Delivery Manager Pune Read More The connection has timed out The server at www.nihilent.com is taking too long to respond. The site could be temporarily unavailable o...
projectmanagement java delivery customerrelations pound access firefox firewall unloading Munin GlusterFS Varnish Dovecot Squid OpenVPN Cacti Proxy Bind MonarchPro ep tingJob And Resposibilties: - Build, Monitor and maintaining servers. Hosting Websites and creating domain on dedicated servers. Taking periodic backup from server and maintaining records. Worksta...
lan wan dns vpn gre unix dhcp linux mysql ipsec apache windows freebsd xcel tunnelsIntroduction The IBM Cloud is looking for a talented, innovative and enthusiastic Software engineering professional that will build the next generation cloud technical support to make our customers su...
troubleshootingnetworking lanoperating systems switchesweb hosting web serverswindows serverEngineering Shivajinagar, Pune Essential Duties and Responsibilities: Work with both development and QA teams with a focus on automating build and deployment Design and develop a continuous deploy...
open source toolsapplication design awspython mavenconfluence gitjava jenkinsdesign paJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Experience L2/ l3 Protocol Testing and networking concepts: VLANs, OpenVPN, ipt...
protocoltesting php cms html perl ruby vlan mysql python design testing openvpn iptables scripting javascript 3protocoltesting protocol netw kingUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gre sql bash dhcp ospf dns vpn wan vlan lan iis perl unix hpDesign, plan, execute Oracle DB/RAC certification projects. Work with Oracle to agree on specific test details including new technology, new product features, and/or platform variations. Lead and exec...
fibrechannel audiomastering developmenttools spectrummanagement softwaredevelopment PowerVM AME DLPAR Java HTML PHP JQuery Shell Perl owerHAEngineering Shivajinagar, Pune Essential Duties and Responsibilities: Work with both development and QA teams with a focus on automating build and deployment Design and develop a continuous deploy...
open source toolsapplication design awspython mavenconfluence gitjava jenkinsdesign paJob Requirement: Job Profile Design & Development , Should be able to lead a team , Individual ContributionSkillsets Exp. on L2/ L3 protocols development in C/ C - 802.1Q, GRE, VXLAN, L2VPN, MPLS,...
sixsigma msoffice cloudcomputing pmp san bgp gre java itil sfdc itsm mpls vlan avaya cloud l2vpn isis design 3protocols
Areas of Responsibility
Understand the customer s retail business domain quickly and align architectural design with the customer s existing environment.
Work as t...
private cloudshell scripting retail businesscomputer science operating systemsvpn configuration technical liaisoncorporate liais
Areas of Responsibility
Understand the customer s retail business domain quickly and align architectural design with the customer s existing environment. Work as technical...
private cloudshell scripting retail businesscomputer science operating systemsvpn configuration technical liaisoncorporate liaisUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gre sql bash dhcp ospf dns vpn wan vlan lan iis perl unix hpJob And Resposibilties: - Build, Monitor and maintaining servers. Hosting Websites and creating domain on dedicated servers. Taking periodic backup from server and maintaining records. Worksta...
lan wan dns vpn gre unix dhcp linux mysql ipsec apache windows freebsd xcel tunnelsFull time live-in position. Act as proxy parents and be responsible for nurturing and parenting the hostel students,...
poundMunin GlusterFSVarnish DovecotSquid OpenVPNCacti ProxyBindEngineering Shivajinagar, Pune Essential Duties and Responsibilities: Work with both development and QA teams with a focus on automating build and deployment Design and develop a continuous deploy...
open source toolsapplication design awspython mavenconfluence gitjava jenkinsdesign paUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gre sql bash dhcp ospf dns vpn wan vlan lan iis perl unix hpEngineering Shivajinagar, Pune Essential Duties and Responsibilities: Work with both development and QA teams with a focus on automating build and deployment Design and develop a continuous deploy...
open source toolsapplication design awspython mavenconfluence gitjava jenkinsdesign paJob Description Technical Competencies: Experience in the Software Defined Networking and Open Flow. Experience in working with the SDN controllers like ONOS (preferably) and ODL. Hands on exp in ...
java mysql jsp hibernate spring opensource loadbalancing datastructures operatingsystems softwaredevelopment designspecifications applicationprogramming applicationdevelopment oftwaredefinednetw king educaProject Manager / Program Manager Delivery Manager Pune Read More The connection has timed out The server at www.nihilent.com is taking too long to respond. The site could be temporarily unavailable o...
projectmanagementjavadeliverycustomerrelationspoundaccessfirefoxfirewallunloadingMuninGlusterFSVarnishDovecotSquidOpenVPNCactiProxyBindMonarchProtingJob And Resposibilties: - Build, Monitor and maintaining servers. Hosting Websites and creating domain on dedicated servers. Taking periodic backup from server and maintaining records. Worksta...
lanwandnsvpngreunixdhcplinuxmysqlipsecapachewindowsfreebsdxceltunnelsUnix / Linux administration experience: Linux / FreeBSD / OpenBSD , Apache , MySQL , Firewalls (ipfw , pf , iptables) , VPN (openvpn , ipsec GRE tunnels) Windows administration experience: Server 200...
gresqlbashdhcpospfdnsvpnwanvlanlaniisperlunix
© 2019 Hireejobs All Rights Reserved