pc insurance marketing jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

pc insurance marketing Job Openings

Showing 18201 - 18250 of 48557 Jobs

Hr Executive

H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Area Sales Manager

Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Channel Sales Manager

INDIAEXCITE IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Hyderabad,Bangalore, Chennai, Coimbatore 01 Apr, 2025

distribution handling

sales

personal loans

Process Associate

STRYDE CONSULTING SERVICES Fresher Hyderabad 01 Apr, 2025

icse

excellent communication

Franchise Sales Manager

MEGMA SERVICES 7.00 to 12.00 Years Hyderabad,Other Telangana, Bangalore, Chennai, Pune, Mumbai City, Ranchi 01 Apr, 2025

franchsie development manager

franchise sales manager

Regional Sales Manager-Project sales( construction chemicals)

MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

Senior Ar Caller - Hospital Billing
AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Mumbai City 01 Apr, 2025

HIRING FOR AR CALLER / SENIOR AR CALLER !! Experience : Minimum 1Year Location : Mumbai, Hyderabad

Minimum 1 Years of experience ...
ub04cms-1500denial managementar callingmedical billingar calling medical billingus healthcareclient partnerar caller

AR Caller / Senior AR Caller - Denial Management
AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Experience and Skills Required

Minimum 1 Years of experience in AR Caller (Voice)

Knowledge of Physician Billing or Hospital Billing and D...
ub04us healthcaremedical billingcms-1500ar callingar calling medical billing

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

RELIANCE LIFE INSURANCE - SPOT OFFER - ON ROLE - HIGH CTC - PAN INDIA
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Job Role : Senior Relationship Manager, Greetings! Roles & Responsibilities,

Candidate has to work on the leads provided by the Organization.

Cand...
life insuranceagent recruitment

Insurance Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Job Summary: As a Frontline Sales Representative, you will interact directly with customers to generate leads, drive sales, and build long-term rel...
frontinsurancesaleslinedirect

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Design Intern
swifnixcom 0.00 to 4.00 Years Gwalior,Other Madhya Pradesh 01 Apr, 2025

Required Skills and Qualifications: Proficiency in design tools such as Adobe Creative Suite (Illustrator, Photoshop, InDesign) or Sketch, Figma, or similar. Strong understanding of design princ...
Adobe Creative SuiteCoral DrawHTMLCSSJavaScriptSketchFigma

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Sr. Solar Sales Specialist
Jobs Territory 1.00 to 5.00 Years Gwalior,Ongole, Tirupati, Vijayawada, Hyderabad, Vishakhapatnam, Other Uttar Pradesh 01 Apr, 2025

Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing leads being assigned are foll...
salesnetworkingnegotiationrelationship managementgoodlead generationsolarskills

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Urgent Hiring for Field sales executive for Hyderabad, Prayagraj , Visakhap
Jobs Territory 1.00 to 4.00 Years Gwalior,Ongole, Tirupati, Hyderabad, Other Andhra Pradesh, Vijayawada, Vishakhapatnam 01 Apr, 2025

Sr. Solar Sales Specialist Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing le...
solar energysalesfield sales

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Profiles to be source-Agency Direct - in Life Insurance
ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Need Candidate for Telecaller regarding Real State
Alliance Solutions 0.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

Job description Real Estate Telecaller Sales & Lead Generation Location: Lalru (Near Derabassi), Zirakpur Salary: Up to 20,000/month Attractive Incentives Work Schedule: 6 Days/Week Cab Facilit...
real estate marketingreal estate sales

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Sales Manager
Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

We are looking for a motivated Associate Agency Development Manager to support the recruitment, training, and growth of agency teams. The ideal cand...
marketingsales

Openings for Life Insurance Sector- Delhi location (CTC up to 5 LPA)
ATS Infovision 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. : hidden_mobile or just a message on whatsapp with Yes to get a call back <...
direct salesinsurancecasa salesbankingfield workdirect channel saleslife insurancedirect marketing

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

for Sales Warrior & Relationship Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Other Kerala,Chennai, Other Tamil Nadu 01 Apr, 2025

JobDescription Direct Marketing Channel Designation: Sr. Relationship Manager/Executive Relationship Manager Roles & Responsibilities...
agency channelsalesinsurance salesmarketingbusinessagency

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

OVERHEAD TRANSMISSION LINE EGINEER AND TECHNICIAN
CAREER ZONE STAFFING SOLUTIONS 8.00 to 13.00 Years Ernakulam,Idukki, Kochi, Kottayam, Wayanad, Other Kerala, Bangalore, Other Tamil Nadu, Chennai, Ahme 01 Apr, 2025

WE REQUIRE ENGINEERS, TECHNICIAN, TEAM LEADER, SUPERVISOR AND FOREMAN FOR AN OVERHEAD TRANSMISSION LINE(OHTL). MINIMUM OF 8 TO 10 YEARS EXPERIENCE REQUIRED IN OHTL. AGE LIMIT UPTO 40 YEARS OLD. ...
power distributionelectrical engineeringpower transmissionelectrical maintenance

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

Territory Sales Manager
Linways Technologies 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Kochi, Kerala Work Type: Full Time Location : Mangalore, India(Candidates who are willing to relocate can apply) B2B Corporate Sales Aggressively use phone, emails and other sales & marketing t...
Sales PresentationsCRM ManagementB2B Corporate SalesSalesMarketing

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

Front Office Assistant
Five Star Resort 1.00 to 5.00 Years Other Kerala 01 Apr, 2025

FRONT OFFICE ASSISTANT VACCANCY AVALIBLE AT NIRAAMAYA RETREATS KUMARKOM KOTTAYAM 1. MALES PREFERED 2. HANDLE ALL THE OPERATIONS OF FRONT OFFICE 3.MUST BE CONFIDENT IN MANAGING GUEST 4.MUST BE ...
English

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

PREV
NEXT

pc insurance marketing Job Openings

Key Responsibilities:

Job Description / Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Key Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing