project planningbilling engineer jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

project planningbilling engineer Job Openings

Showing 34051 - 34100 of 43735 Jobs

Desktop Support Engineer L1

Hoopoe Infoedge Pvt Ltd 0.00 to 1.00 Years Chennai 01 Apr, 2024

Desktop Support

Hardware issues

Software Engineer

MulticoreWare 1.00 to 3.00 Years Chennai 01 Apr, 2024

Business Analyst

Yaali Bizappln Solutions 1.00 to 3.00 Years Chennai 01 Apr, 2024

Excellent written

verbal communication skills

Business analyst (Claims)

LTIMindtree 6.00 to 9.00 Years Chennai 01 Apr, 2024

Area Manager

Market Xcel Data Matrix Pvt Ltd 3.00 to 7.00 Years Chennai 01 Apr, 2024

Team Lead, Technology, Project Management, Corporate Banking; Lead...

DBS Bank 8.00 to 12.00 Years Chennai 01 Apr, 2024

Site Reliability Engineering

Sales Engineer

CP HR SERVICES PVT LTD 2.00 to 3.00 Years Chennai 01 Apr, 2024

Position: Sales Engineer

Experience:2- 3yrs

Age (Below): 28 Years

salessales networking

Civil Technician

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Chennai 01 Apr, 2024

tools

engineering

geotechnical engineering

design

walls

transportation engineering

data

collection

environmental engineering

Executive Assistant

MILLENNIUM BABYCARES PRIVATE LIMITED 15.00 to 23.00 Years Chennai 01 Apr, 2024

provides administrative support

executive assistant

Civil Engineer

SUNITA AGRI EXPORTS PRIVATE LIMITED 1.00 to 5.00 Years Chennai 01 Apr, 2024

Civil Engineer Responsibilities:

Developing detailed designs.
Doing feasibility assessments and site inspections.
Prepar...
civil supervisioncivil site engineeringcivil engineeringengineering design services

Biomedical Engineer

M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Chennai 01 Apr, 2024

Design equipment and devices, such as artificial internal organs, replacements for body parts, and machines for diagnosing...
medical devicesultrasound machinesbiomedical engineeringbiomaterialshvac equipmentshealthcarepatient safetyultrasoundhospitals

UHT Operator
MMK ENTERPRISES 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Please find the below job Details: Required UHT Operator Commissioned of UHT Infusion Plant . Responsible to complete UHT production & Filling line project. Installation and commissioning commissioninginstallation

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect)
AATRAL TECHNOLOGIES INDIA PRIVATE LIMITED 7.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title: SAP Finance Subject Matter Expert (SME/Module Lead/Solution Architect) Job Responsibilities:

Work as a SAP Finance Subject Matter Expert ...
sap fico - financial accounting / controllingsap ficofico

Product Owner Busines Analyst
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 6.00 to 11.00 Years Bangalore 01 Apr, 2024

Required Product Owner: 4 years of product owner / business analyst / product management or related experience Business Analysis: 0-3 years of product owner / business analyst / product managem...
use casesdevopsazureagile project managementagile developmenttest case matrixazdo

Electronics Design Engineer
Spotlight Recruitment Services 0.00 to 1.00 Years Bangalore 01 Apr, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & ab...
automobilecivil engineering

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Sales Engineer
POST A RESUME 1.00 to 5.00 Years Bangalore 01 Apr, 2024

Qualification: B.E/B.Tech/Diploma in Electrical/Mechanical (Mandatory) Location :Ahmedabad/ Delhi/ Noida/Gurugram/ Andhra Pradesh/Hyderabad/ Telangana/ Bangalor...
saleshvac sales

Event Designer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Have you ever found yourself at a wedding or corporate event where you were awed by the detail put into the decor There is a very good chance an event designer was behind it all. Event designers...
tradetransportationlogisticsmanagementcorporatebudgetaudiovisualbudgetsexternalcommunityeventsgroundshows

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

Production Support Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 20.00 Years Bangalore 01 Apr, 2024

Product support engineers handle technical requests filed by end users of a companys product or system. Their primary responsibility is troubleshooting and resolving errors, and throughout their ...
supportsystemdatamanagementserverproductionsqlapplicationenvironmentincidenttechnicalwarehouse

Facility Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

We are looking for a facilities engineer to be responsible for the maintenance and improvement of our manufacturing plant. You will be responsible for assessing the facilitys resource req...
admin facilities managementproduction facilitiesfacility operationsfacilities engineeringfacilitated processfacility managementpublic administrationpublic financefacility administration

Consulting Engineer
MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 19.00 Years Bangalore 01 Apr, 2024

A consulting engineer advises clients on the planning, design, and construction of projects. They can be licensed to practice any technical specialty, including but not limited to mechanical, ele...
project managementjenkinsproduct developmentazurejavaemerging technologiesdata analysisvirtualizationlinux

Senior Azure Engineer
LTIMindtree Limited 8.00 to 12.00 Years Bangalore 01 Apr, 2024

We are hiring for the position ofSenior Azure Engineer at LTI Mindtree Responsibilities

Design and develop Infrastructure as code to deploy Azure r...
azurekubernetessqldevops

Assistant Site Engineer
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job description Overall Planning and Execution of work from receipt of BOQ to Site completion delivering Quality on Time and Within Budget. To turn clients decisions in our Favour & making pr...
project controlproject schedulingproject handlingmonitoringsite initiationsite planningboq preparationcivilbusiness process

TELECOM SITE ENGINEER Saudi Arabia
GLOBAL WINGZ CAREERS Hiring For Engineering company 5.00 to 10.00 Years Bangalore 01 Apr, 2024

Job Title TELECOM SITE ENGINEER Industry of the Employer (only in case of job posting) CIVIL CONSTRUCTION / OIL & GAS Number of Vacancies 25 engineering servicestelecom engineeringmechanical engineering

Site Supervisor & Site Engineer (Civil & Mechanical)
The JSM Engineers 0.00 to 2.00 Years Bangalore 01 Apr, 2024

Job Details

Required Qualification: Dipl/Deg in Mechanical/Civil

Required Location: Hazira, Jamnagar, Pune, Dahej, Bangalore

Required Experience: 0...
siteconstruction safetysite managementsite supervisionsite engineeringcivil engineeringsite executionmechanical engineering

Mechanical Engineer,Civil Engineer, Site Engineer
Sree UGCL Projects Ltd 3.00 to 4.00 Years Bangalore 01 Apr, 2024

Hi Looking for candidates experience in construction or infrastructure filed for our Ramanagar and Magadi projects , worked on gov related projects, road, Pipline, water treatments etc. 10 positi...
pipelinecivil engineering

Civil Site Engineer
Spotlight Recruitment Services 1.00 to 0.00 Years Bangalore 01 Apr, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualificati...
automobilecivil engineering

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

Urgent Hiring for Site Engineer
Manpower Solution Fresher Ahmedabad 01 Apr, 2024

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management

Junior Embedded Hardware Engineer
Bioscan Research 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

Company Description Bioscan Research is focused on improving traumatic brain injury patient outcomes through early detection using the CEREBO, a machine learning-powered NIRS device. The company ...
Circuit DesignEmbedded Software DevelopmentSchematic CaptureI2CUARTEthernetSoftware Development MethodologiesSignal ProcessingMachine LearningElectronics Hardware DevelopmentEmbedded Systems DesignMicrocontrollerMicroprocessor ArchitectureReal

Sr. Hardware Engineer
Electrify Services 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Position Title: Hardware Engineer Full Time Electrify Services is one of the fastest-growing engineering services start-ups and is looking for a Sr. Hardware Engineer to play a key role in helpi...
RS485SPIUSBCANZigBeeWiFiGPSGSMWiFiBluetoothSD CardcameraLCDSystem integrationCommunication systemsTeam leadershipHighfrequency electronic circuitsEmbedded hardware products designMixed signal circuit designLowpower circuit designHig

Electronics Hardware Engineer
Multispan Control Instruments 1.00 to 4.00 Years Ahmedabad 01 Apr, 2024

Job Description We are seeking an experienced Electronics Hardware Engineer to join our team. The ideal candidate will have a strong understanding of electronics hardware design and a passion for...
Electronics hardware designAnalogdigital circuit designPrototype testinganalysisComponent sourcingEmbedded systems firmware programmingDevelopment of production test specificationsPreparation of bills of materialsPCB layout

Corporate Sales Executive in Ahmedabad
BDNT Labs Private Limited 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Key Responsibilities Create a network strategy plan to secure an adequate dealer footprint for current and future business including investment request and involve feasibility study Look for new...
Business PlanningProject ManagementDealer ManagementMarket ExpansionNetwork Strategy PlanningFeasibility StudyCustomer Satisfaction ManagementGlobal Team CollaborationFacilities Standardization

Hardware Engineer
VMukti Solutions 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Hardware Engineer No. of Openings : 1 Experience Required : 2 year Location : Ahmedabad Education Qualification: Any technical Graduate/Post Graduate (Graduate from EC & IC is preferred) Key Ski...
Knowledge of CCTV HardwarePCBsKnowledge of RepairAssembly activity of HardwareUnderstanding of Technical toolsPCB layoutsDrawingsDesignsKnowledge of Firmware

Senior Hardware Engineer
Oxit India 7.00 to 11.00 Years Ahmedabad 01 Apr, 2024

Oxit is a pioneering IoT and design service company seeking a Senior Hardware Engineer to enhance our engineering team. This role is essential for client interfacing during technical reviews and d...
Hardware DesignSchematic CaptureLayout DesignAltium DesignerAnalog Circuit DesignDigital Circuit DesignMicrocontrollersPower ManagementBluetoothWiFiZigbeeProject DocumentationIoT TechnologiesRF Communication

Assistant Manager / Deputy Manager - Internal Audit
UpMan Placements 10.00 to 14.00 Years Ahmedabad 01 Apr, 2024

UpMan Placements has an exciting career opportunity with one of our esteemed clients from the Construction industry. Role - Internal Audit Level - Assistant Manager / Deputy Manager Location - ...
Compliance ManagementProject ManagementClient ManagementSite AccountingCostingBudgetingMIS ReviewCost ControlReduction

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

Data Entry Operator, Work From Home, Part Time
LAXMI TECHNOLOGY 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Greetings, We AreGovt. Reg. AndGenuine Data Entry service provider, In All over India. For more details Contact Our Project Manager90hidden_mobil...
excelfreelance writingwork from home typingdata entry operationfreelance typingmanualfreelance editing

Hiring For Electrical Engineer Fresher or Experience
Divya Staffing Solution 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

We are looking for a skilled mechanical engineer to join our team. You will be responsible for working on all stages of our production cycles, from research and design to manufacturing, installat...
maintenancearchitectureinterior designingtechnician activities

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Vijayawada 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

Hiring For Electrical Engineer Fresher or Experience
Divya Staffing Solution 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

We are looking for a skilled mechanical engineer to join our team. You will be responsible for working on all stages of our production cycles, from research and design to manufacturing, installat...
maintenancearchitectureinterior designingtechnician activities

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vijayawada 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Cargo Officer
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

A Cargo Officer, also known as a Cargo Agent or Cargo Handler, is responsible for the efficient handling, processing, and transportation of cargo goods within various modes of transportation, suc...
forwardingcargo managementproject cargocargologisticscargo operations

Data Entry Typing (Work From Home )
Learning Planner 0.00 to 1.00 Years Vellore 30 Mar, 2024

We are in urgent need of Data EntryTyping(Work From Home Jobs) who is dedicated and serious about his/her work. We have various types of online and offline project works. Responsibiliti...
typing speeddata entry operationms exceltypingms wordwork from home

Hiring For Research and Development
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are seeking a talented R&D engineer to assist with the design and testing of our new range of products. In this role, you will be working closely with the R&D team to create functional design ...
analysisdevelopmentmanufacturingresearch

Mechanical Production Engineer
Spotlight Recruitment Services 0.00 to 1.00 Years Vellore 30 Mar, 2024

We have an urgent hiring forMechanical Engineer Civil Engineer Electrical Engineer Automobile Engineer Candidate Profile: Age: Between 18 and35 years Educational Qualification: HSC (102) & ab...
automobilemechanical maintenance

PREV
NEXT

project planningbilling engineer Job Openings

Position: Sales Engineer

Experience:2- 3yrs

Age (Below): 28 Years

Civil Engineer Responsibilities:

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi... construction site managementsite executionsite supervisionsite coordinationsite management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management