recommending profit jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

recommending profit Job Openings

Showing 4051 - 4100 of 4317 Jobs

Marketing Activation

Dots Connect 1.00 to 6.00 Years Bangalore 16 Oct, 2023

Our client is a leading Manufacturing company in India. Currently they are setting up BTL Marketing Team across India.

Key Responsibilities (KRAs)

1. I...
activationsvisual merchandisingmarketingbtlsignage systemstrade shows

Jio Center Manager
Jio Platforms Limited 10.00 to 14.00 Years Jharsuguda 12 Oct, 2023

Job Title: JioCenter Manager Industry: Telecom Functional Area: JioBusiness Operations & Planning Experience: 10 to 14 years Annual CTC: 09 To 12 LPA Qualification: Graduation degree in any ...
customer acquisitionsales operationscommercial salescost optimization

Opening for senior accountant dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Rajahmundry 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
document controlaccountingdata entrysalescashierslogistic regressionsales process

Relationship Officer
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 5.00 Years Pondicherry 12 Oct, 2023

The Secured Micro Loan Business segment product line caters to funding short term and medium term working capital needs of Small Businesses and individuals, via a suite of customized sho...
lapdirect sales

Marketing Activation
Dots Connect 1.00 to 6.00 Years Patna 12 Oct, 2023

Our client is a leading Manufacturing company in India. Currently they are setting up BTL Marketing Team across India. Key Responsibilities (KRAs) 1. I...
activationsvisual merchandisingmarketingbtlsignage systemstrade shows

ICICI Bank hiring for SME -Relationship Manager (Business Banking) role in Patna
ICICI Bank Ltd 8.00 to 13.00 Years Patna 12 Oct, 2023

Job Description-Relationship Manager-Wholesale Banking Group (Mid-Corporate Group)

Applications are Invited from across Industries working capitalrelationship managementasset based lendingfundingcross sellingbusiness bankingterm loancredit appraisalssme banking

Java Project Manager
Infosys Limited 5.00 to 11.00 Years Pune 12 Oct, 2023

We are seeking a highly experienced Java Project Manager to join our team. As a Project Manager, you will be responsible for leading and managing the development of Java-based software projects fr...
deliveryproject managementcustomer relationsreportingjavasubject matter expertsidentifying new opportunitiesproject plansproblem solvingproject planningsoftware projectsagile methodologiesbusiness requirementsprogramming languagesarchitectur

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Nagpur 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

Immediately hire for Data Entry Cashier and Sales in Dubai apply now
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mysore 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data analysiscashier activitiessalesaccountingdocument controlcashiersaccount managementdata entrylogistic regression

Social Impact Executive
TEAM STREET CONSULTANCY PRIVATE LIMITED 0.00 to 4.00 Years Mumbai City 12 Oct, 2023

About Medecins Sans Frontires: Medecins Sans Frontires, also known as Doctors Without Borders, is a non-profit international humanitarian organization that provides medical aid t...
salesfield marketingfield work

Sales Associate
Talent Corner HR Services Pvt Ltd 2.00 to 7.00 Years Mumbai City 12 Oct, 2023

Job Title: Sales Associate Qualification: Bachelors degree Reporting To: Associate Director Location- Mumbai - Govandi Job Summary: Myna Mahila is looking for a result-drive...
salesb2c

Category Executive
Orbitouch Outsourcing Private Limited 2.00 to 7.00 Years Mumbai City 12 Oct, 2023

Urgent Hiring ForCategory Executive||Experience- 2 years||Location- Goregaon East(WFO) Profile- Category Executive- Global Business Research (Business Development) Experience- 2 years Ctc-upto...
category theorycategory managementcategory managersocial media activities

Urgent Hiring For Accountant, Cashier, Banking Operation, Finance Analyst
Kartik Kumar Joshi Hiring For Gita Consultancy 0.00 to 1.00 Years Kochi 12 Oct, 2023

Accountant Responsibilities:- Complying with the company, state, and country accounting and financial regulations. Compiling, analysing, and reporting financial data. Creating...
account managementaccountingbanking productscashiersbanking operationscash handling

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Kochi 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

Operations Officer
Elevatelife Products Private Limited 8.00 to 0.00 Years Kakinada 12 Oct, 2023

The Process Manager (sometimes known as a Process Development Manager) is responsible for taking a product through from original idea to production line, ensuring that all technical standards are...
u.s. office of foreign assets controloperationsoperational risk managementoperations management

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

.Net Project Manager
Infosys Limited 5.00 to 13.00 Years Hyderabad 12 Oct, 2023

We are seeking a highly experienced .NET Project Manager to join our team. As a Project Manager, you will be responsible for leading and managing the development of .NET projects from start to fin...
deliveryproject managementcustomer relationsreportingjavasubject matter expertsidentifying new opportunitiessoftware development methodologiesproject planscloud computingproblem solvingversion controlproject planningagile methodologiessoftwa

Asst Manager - Private Equity Fund Accountin
NTT Global Delivery Services Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Roles and Responsibilities

Review Booking Journal Entries basis bank statements and client

Review of Bank Reconciliation and maintaining the respectiv...
cash flowhedge fundsprivate equityjournal entriesbank statementsfinancial reportingbank reconciliationfinancial justificationcashcapitalbespokeexpensesreportingportfoliomanagementmonitoringmaintenanceperformanceliabilities

Android Developer
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 4.00 to 5.00 Years Gurugram 12 Oct, 2023

Job Role – Android developer (mobile devices and TV). Preferred domain experience: OTT , Media , Video , Audio space Good analytical ability to attack problems that are very unusual and ex...
AndroidAndroid StudioJavaAndroid frameworkJavaJavaJavaScriptJSONHTMLKotlinFireTv

Finance Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Gurugram 12 Oct, 2023

Finance managers are business specialists who manage important financial functions of an organization. They produce financial reports, manage investment activities, and create strategies and plan...
organizationproblem solvingdecision-makingmathematicscommunication skills

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Production Supervisor, Production Manager, Production Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Production Manager Job Responsibilities:

Supports the senior producer and assists the team by focusing on schedules, velocity tracking, and dependency management
...
managementfilm productionprocess improvementmilestonesproposalsoddhigh level of organizationqualitysetsafetyproduction planninghandle multiple projectsquality controldependency managementinspectionvelocityfilmtelevisionproject management

Accountant
S P Jagannath & Sons Hiring For Accountant 5.00 to 8.00 Years Delhi 12 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
balance sheet finalisationtaxationaccountingaccounts finalisationbank reconciliationbranch accountingtaxgoods

Home Lending Risk Strategic Analytics - Associate
JPMorgan 0.00 to 4.00 Years Bangalore 12 Oct, 2023

The HL Risk Strategic Analytics team spans the globe, primarily sitting in Plano, TX and Bengaluru, India, however we have staff and executive presences across 9 locations worldwide: Plano TX, C...
source system analysismusic makingloan servicingrisk managementcapital marketsdata manipulationstrategic analyticsrelational databasescompatibility testingfinancial justificationmissassqlriskstemtrustoraclecredit

Urgent requirement for Tax Manager Consulting post in Kampala.
POST A RESUME Hiring For Financial Services Company 3.00 to 8.00 Years Ahmedabad 12 Oct, 2023

Company Profile: Audit, Tax and Advisory firm located in Kampala, Uganda Designation: Tax Manager Consulting Location: Kampala Experience Range: 3.0 To 6.0 yrs Salary Range: - 20.00 To 30.00 Jo...
chartered financial analystexternal audittaxationcompliancefinanceauditing

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Vishakhapatnam 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Head Cashier in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Pune 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Package Consultant SuccessFactors Core HR
IBM India Pvt Limited 0.00 to 4.00 Years Pune 10 Oct, 2023

Introduction In this role, you ll work in our IBM Client Innovation Center (CIC), where we deliver deep technical and industry expertise to a wide range of public and private sector clients around...
trusted business advisorfit analysishybrid clouddata migrationbusiness rulesprivate sectoruser experienceresolving issuesinterpersonal skillstechnology platformsimplementation planningsapapimdfredfitexcelclouddesign

Marketing & HR Manpower Organiser
S P Jagannath & Sons Hiring For Marketing & HR Manpower Organizer 5.00 to 8.00 Years Noida 10 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
hiringteam motivationsaleshr administrationmanagement skillsvendor managementhr operationsteam managementteammanage marketing manpower

Immediately hire for Data Entry Cashier and Sales in Dubai apply now
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mangalore 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data analysiscashier activitiessalesaccountingdocument controlcashiersaccount managementdata entrylogistic regression

Data Solutions - ESG Analytics and Portfolio Insights Associate
JPMorgan 10.00 to 12.00 Years Mumbai City 10 Oct, 2023

Team Background The ESG Analytics and Portfolio Insights team is a part of the Data Solutions organization within the Corporate and Investment Bank (CIB)s Securities Services ...
key performance indicatorsmarket datadue diligencemiddle officedata solutionscustom reportsproblem solvingclient reportingfinancial marketscritical thinkingscenario analysisproduct developmentbusiness requirementsfinancial justificationclien

Territory Manager
ESSAE DIGITRONICS PRIVATE LIMITED 1.00 to 6.00 Years Hyderabad 10 Oct, 2023

Duties and Responsibilities: Excellent communication and ability to convince others. Focus on winning prospective customers as well as maintaining relationship with existing on...
earthmovingcapital equipmentsheavy machineryb2b salesindustrial salesheavy equipment

Marketing & HR Manpower Organiser
S P Jagannath & Sons Hiring For Marketing & HR Manpower Organizer 5.00 to 8.00 Years Delhi 10 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
hiringteam motivationsaleshr administrationmanagement skillsvendor managementhr operationsteam managementteammanage marketing manpower

Warehouse Supervisor Accountants in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Bangalore 10 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Insurance Advisor
MAHALAXMI GRAND WHEELERS LLP 2.00 to 3.00 Years Ahmedabad 10 Oct, 2023

INSURRANCE ADVICER RESPONSIBLITY

Learning and understanding company insurance products.

Answering calls and responding to customer complain...
client relationship managementcommunication skills

Hiring For Centre Director For Corporate Pre School at Sector 62 Noida
HR Globe Recruitment Service 3.00 to 8.00 Years Noida 06 Oct, 2023

Dear Team, Hiring For Centre Director For Corporate Pre School at Sector 62 Noida Designation Centre Director / Asst Centre Director Qualifications Degree in Early Childhood Education (preferr...
customer serviceearly childhood educationpreschoolleadership developmenttoddlerschild developmentteam handling

Team Leader
GFL RECRUITMENT PRIVATE LIMITED 3.00 to 4.00 Years Mumbai City 06 Oct, 2023

Job Description
Main duties:

To lead a designated team of fundraising executives to generate funds for WWF India from individual donors.

Accountable for handling m...
team handlingteam leading

BG Delivery Manager
Nokia Solutions and Networks India Pvt Ltd 5.00 to 6.00 Years Mumbai City 06 Oct, 2023

Join us in creating the technology that helps the world act together We are a B2B technology innovation leader pioneering the future where networks meet cloud. At Nokia you...
project managementjavadeliveryreportingcustomer relationsstrong interpersonal skillssales processproject deliveryproject managerswork effectivelyproject executioncustomer intimacystrategic thinkingresource allocationrevenue recognitioncommu

Branch Manager- Retail Agency
SBI Life Insurance Company Limited 5.00 to 10.00 Years Mumbai City 06 Oct, 2023

SBI Life Insurance hiring for Branch Manager-Retail Agency Channel. Position Title: Branch Manager Location:Andheri/Ghatkopar/Chembur<...
field salesbranch managementinsurance salesteam handlingirda certifiedagency channelbranch salesagency salesagent recruitment

Business Analyst
Birlasoft (India) Limited 5.00 to 7.00 Years Hyderabad 06 Oct, 2023

* . Job role : Business Analyst Exp : 5 to 7 yrs Location : Mumbai. Business Analysis Requirement Gathering & Analysis Product Management Software Development Lifecycle Project Development Lif...
customer relationsdocumentationrequirementsfunctionalbusiness requirementssoftware development life cyclebusiness process mappingproduct lifecycle managementenvironmental impact assessmentuse casetest casesprocess flowuser storiessystem study

Assistant Manager - Finance
Morpheus Human Consulting Pvt Ltd 0.00 to 2.00 Years Mumbai City 04 Oct, 2023

Job Title: Assistant Manager Financial Planning & Auditing - Mumbai Our client focus is to provide loans to low and middle-income individuals, who want to buy or build their own homes. A major...
ms worldchartered accountancychartered financial analystms excelfinancial planningfinancial auditingteam management

Operations Executive
MULTI RECRUITERS 0.00 to 2.00 Years Navi Mumbai 04 Oct, 2023

Candidate Should have:

Fresher and Experience both can apply for this post.

Doing Month endActivity.

C...
branch managementbranch administrationbranch handlingbranch accounting

Operations Executive
MULTI RECRUITERS 0.00 to 2.00 Years Hyderabad 04 Oct, 2023

Candidate Should have:

Fresher and Experience both can apply for this post.

Doing Month endActivity.

C...
branch managementbranch administrationbranch handlingbranch accounting

Accounts Executive(Shipping)(Immediate Joiner)
Busisol Sourcing India Private Limited Hiring For Busisol 2.00 to 5.00 Years Chennai 04 Oct, 2023

Proficient in preparing Bank Reconciliation statements and financial statements. Having good exposure ofaccountingSoftware (ERP-9,Tallyprime) and MS office. Budgeting,GST,TDS Experience ...
accounts finalisationgstjournal entriesaccount executivescash receiptsaccounts payabletds

Hiring Business Development Manager for a Leading Plastic Industry
POST A RESUME 8.00 to 10.00 Years Ahmedabad 04 Oct, 2023

Identify and discover new potential customer and their needs

Contact existing customers for any new product, service or improvement

Develo...
sales planningbusiness developmentsales

Hiring For Sales Officer - Nagpur
ESSAE DIGITRONICS PRIVATE LIMITED 1.00 to 5.00 Years Nagpur 03 Oct, 2023

Job Title: Sales Officer /Territory Manager Report to: Regional Manager Required Qualification: Any Degree, MBA, Diploma, BE, Diploma Experience required: 1-4yrs We need Male candidatefromWei...
industrial machineryheavy machineryindustrial productsmaterial handling equipmentsindustrial salesb2b salescapital equipmentsheavy equipmentearth moving

Urgent Position Branch Manager_ Bank_ Belgaum, Navi Mumbai, Thane, Bangalore
V-Konnect Associates Hiring For Urgent Position_ Branch Manager_ Bank_ Belgaum, Navi Mumbai, Thane, Bangalore 5.00 to 10.00 Years Navi Mumbai 03 Oct, 2023

Strategy & P&L Management

Maintains the Profit and Loss statement and Balance Sheet for the branch

Executes the Branch Strategy in line with the overall Bran...
team handlingretail branch banking

Assistant Manager Audit
Morpheus Human Consulting Pvt Ltd 3.00 to 5.00 Years Mumbai City 03 Oct, 2023

Our client focus is to provide loans to low and middle-income individuals, who want to buy or build their own homes. A majority of the customers are first-time home buyers and finds it challengi...
presentation skillsfinancial accountingfinancial planningchartered financial analystchartered accountancyms excel

Professional, Business Systems Analysis
Fiserv India Pvt Ltd 5.00 to 7.00 Years Noida 02 Oct, 2023

Calling all innovators find your future at Fiserv. We re Fiserv, a global leader in Fintech and payments, and we move money and information in a way that moves the world. We connect fina...
creative problem solvingbusiness systems analysispostingfortune 500social mediaproblem solvingtime managementsystem softwarebusiness systemssystems analysisexternal clientsbusiness analysisanalytical skillsmanagement skillscorporate liaison

Branch Operations Manager
MULTI RECRUITERS 4.00 to 8.00 Years Navi Mumbai 02 Oct, 2023

Candidate Should have:

At least 4 Years of Experience in Operations Dept.

Doing Month endActivity.

CTC...
branch managementbranch administrationbranch handlingbranch accounting

PREV
NEXT

recommending profit Job Openings

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers