Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Job Code : JN/55323/2013 Contact Person : Mr.Karthik Industry type : Transportation Position : Regional Manager-FTL/Mumbai Work Experience : 8 to 12 Status : active Hiring Role : Regional Manager-FTL/...
salesmarketingbusiness developmenttargetretailproblem solvingbehavioral trainingeffective communicationftlodcctcemailportalparcelbusinessdraftingtenderingcontractssalesmarketingwarehouseis someone (or in certain cases there may be multiple team leaders) who provides guidance, instruction, direction, leadership to a group of other individuals (the team) for the purpose of achieving a ...
salescustomer relationsslaqualitycoachingit servicesweb servicesteam buildingspecial eventsgroup dynamicsproblem solvingaudio masteringresolving issuesbusiness developmentcommunication skillscustomer relationshipwinsetsalesmarketingsales & marketing Executive for Real estate builder company Good Communication Requirement For Ghaziabad & Gurgaon Location Immediate Joining,...
marketingsalescustomer relationsbusiness developmentadvertisingjoiningSolution FinderFinding DealsProperty FindingResidential HomesReal EstateEntrepreneurshipMarketsalesmarketingfinding opptunitiesJob description : Position : Regional Manager-FTL Location : Bangalore, Mumbai Budgeted CTC : 13-15 LPA Industry: Transportation Experience : 10-15 Years (Minimum 5 years exp r-equired in FTL) Having ...
salesmarketingbusiness developmenttargetretailproblem solvingbehavioral trainingeffective communicationftlodcctcemailtruckportalparcelbusinessdraftingsalesmarketingwarehouseIndustry - Consulting Category - Consulting Job Type - Permanent - Heads up Consulting management team inclusing Business strategy, innovation and Portfolio and projects team - Participate as Steer...
marketingsalesdeliverypeople managementautomationsenior managementbusiness strategyleadership skillsproject managementbusinesssalesmarketingJob Code : JN/45605/2013 Function area : Generating New Business and searching new clients. Daily sales visit to existing and new clients Contact Person : Shashi Narayan Industry type : Logistics Posi...
new businessmusic makingctcwordsalesemailvisitcreditresumebusinessmarketinglogisticsaccountsInternational SalesStrategic PartnershipsSales ProcessChannel PartnersLead GenerationsalesmarketingBusinesstoBusinessSALARY: 3 - 4 lpa LOCATION : Surat, Gujarat VACANCIES: 2 QUALIFICATION: MBA/PGDM in Marketing or related fields MALE/FEMALE: M...
salesmarketingbusiness developmentcustomer relationstargetdue diligencecorporate saleslead generationbusiness growthsalesmarketingendtoend project managementSALARY: upto 4 lacs LOCATION : Ranchi, Bihar, India VACANCIES: 1 QUALIFICATION: Bachelor s degree in advertising, marketing, or related field...
marketingsalesadvertisingbusiness developmentbrand managementb2b salesb2b marketingdigital conversionbrandingidentity marketingsalesmarketing(Internal e.g. colleagues, Sales & Marketing Dept., Unions & etc. External e.g. Legal advisor, customers, distributors, Clients & etc)
Role Purpose: Responsible for the organization-wide Business Strategy, Operations & Business results. Role Profile: - As CEO, you have the overall responsibility for creating, planning, implementing, ...
marketingsalesbusiness developmentfinanceretailcash flow managementnew product developmentcontinuous improvement facilitationcash flowtrade showsbrandingidentity marketingsalesmarketingTele- Marketing Executives at Chennai (22- 28 yrs) required by leading / well established KPO / BPO & Software company in operation since 1995 (20 years). Job involves calling senior company executive...
salesmarketingbusiness developmentaccountstargetindustrial salesbpokposalarytestingsoftwareresearchbusinessbenefitspsychometricsProject SalesSealsIndustrial DistributionsalesmarketingCertified FluidSALARY: 3 to 4 Lakhs VACANCIES: 1 QUALIFICATION: Any graduate MALE/FEMALE: Male EXPERIENCE: 2 to 5 years JOB DETAILS ...
marketingsalescustomer relationsbusiness developmentadvertisingb2b marketingb2bbackendengineeringdocumentationB2C Marketingsalesmarketing
deputy director sales & marketing in bengaluru / bangalore One of our Client leading Haevy Machinery Industry is looking for Deputy Director - Sales...
business developmentadmissionsdeliveryseminarsaccountsnew businessmetal formingsales strategytechnical salescapital projectsproduct portfoliostrategic negotiationturnsalesmetalsalesmarketingAmaze yourself and the world around you Jobs at InnoVita are unlike any other youve had. Youll be challenged. Youll be inspired. And youll be proud. Because whatever your job is here, you will be th...
relationship managementexhibitionssaleschannelsales administrationmarket commchannelssales executivesalesmarketingdistributResponsibilities: 1. Report to Director of Marketing 2. Write product datasheet , product operation manual , product marketing documents 3. Update the content of company s website 4. Create and ...
flyerscompanyproduct marketingmarketingsalesdirectresponsibleteamproductsalesmarketingFreelance writers from anywhere in IndiaOn Target Marketing Solutions, a Navi Mumbai-based digital marketing agency, is looking for freelance writers / content specialists from anywhere in India to jo...
marketingagencytargetsalesgetfreelancerself motivatedpresalesmarketingJob functions area : Marketing / Branding / Promotions Location : Lucknow Experience : 2 - 4 years Skills : BRANDING, PROMOTI...
marketingsalescustomer relationsbusiness developmentadvertisingdigital marketingmarketing strategystrategyIntegrated Brand MarketingPrintBrand AwarenessBrandingbrandingidentity marketingSalesMarketingLocation: Delhi covering North. Industry: FMCG foods. Experience: Minimum 12 years. Presently handling north India as RSM for at least 2 + years. Academic: MBA in marketing is must. Salary: up to ...
salesmarketingbusiness developmentretailtargetchannel salesregional salessalaryIntegrated Brand MarketingPrintBrand AwarenessBrandingbrandingidentity marketingSalesMarketingBrandingIdentityRelatEducation M.B.A/B.B.A Experience Must be having 1 to 5 years experience in same field Skill Excellent Marketing Skill and Communication Skill. ,...
marketingsalescustomer relationsbusiness developmentadvertisingbrand marketingbrandeducationcommunicationIntegrated Brand MarketingBrandCross MerchandisingSponsorship Marketingsalesmarketingmarketing salesJob functions area : Marketing / Branding / Promotions Location : Mumbai Experience : 3 - 5 years Skills : SALES, BRANDING, P...
marketingsalescustomer relationsbusiness developmentadvertisingsocial mediamarketing strategyBrandingRelationship Marketingbrandingidentity marketingSalesMarketingBrandingIdentitySALARY: upto 4 lacs LOCATION : Delhi, NCR, India VACANCIES: 1 QUALIFICATION: Any Graduate MALE/FEMALE: both EXPERIENCE...
digital marketing experiencesocial mediadigital agencydigital marketinganalytical skillsmarketing strategyoral communicationseosalesbrandsalesmarketingSALES & MARKETING MANAGER Qualification: B. E. / Graduation / MBA Industry Type: Marketing Functional Area: Sale and Marketing Minimum 1 year of experience in Sales or Marketing department Fluent...
marketingsalesadvertisingbusiness developmentbrand managementenglishCold CallingSales ProcessDirect SalesSales OperationsSales PresentationsCustomer RetentionsalesmarketingBusinesstoBusinessOutsideRoles and Responsibilities:- 1. Responsible for Digital Sales & Marketing of Emcures Direct To Consumer Brands. 2. Creating Market space for the DTC Brands. 3. Key Performance Indicator a. Brand Pres...
financesalesltdmisaccountancydirect to consumerdigital salescustomer focussuccess storiesdigital marketingdtcbrandpremierplanningmarketingreportingperformancecommunicationsalesmarketingWe are urgently looking for Sr Endocrinologist (National Sales Head) for one of the reputed Pharma Company who will be based in Mumbai & looking for Pan India Sales & Marketing PFB the Synopsys of the...
salesmarketingbusiness developmentretailbudgetingpanpharmabusinessreportingendocrinologyaccountabilityDeferred CompensationsalesmarketingmedicalHuman Resources Information Systems HRISLooking for Result oriented Sales & Marketing professionals with over 3 to 4 years of experience in Real Estate & Construction or Similar Companies. Aiming for senior level positions to manage complet...
business operationscommunication skillsfinding opportunitiesadvertising managementhismailsalesresumebusinessmarketingmanagementoperationsadvertisingeligibilityconstructioncommunicationsalesmarketingaccouPharma Sales & Marketing Consultant The role entails- Advising / assisting Pharmaceutical/CHC Clients (B2C)with regard to : - Sales strategies and plans for the overall growth of market share on a sus...
market shareteam buildingmarket penetrationoptimization strategiespharmaceutical companiessalessoundbusinessplanningmarketingsalesmarketing- 3 -5 years of experience in client facing product or product driven service delivery roles. - Knowledge of business functions like Marketing, Market Research, Sales & Marketing, Customer Relationsh...
customer relationsdocumentationrequirementsfunctionalbusiness requirementscustomer relationship managementdata analyticsmarket researchservice deliveryvendor managementbusiness intelligencesalesmarketingJob Description Hosted, Cloud solutions architecture definition, development and deployment SaaS Services for Sales & Marketing, Fulfillment, Finance and other departments in multiple industries T...
executionplanningfinancepromotionsmarketingdistributionretailsalespricesalesmarketingJob Description Development of business workflows, analysis Client interaction, user requirements gathering Group facilitation, team management , Project and Program Management Functional analysi...
managementclient interactionteam managementclientbusinessmarketingsalesinteractionteamsalesmarketingCompany Name: Do IT Enterprises 3D Designer Qualification/ Exp: Relevant Qualification / Experience Job Location: Paldi, Ahmedabad - Relevant qualification and experience - Minimum 1 year experience ...
b2bdesignmarketingenterpriseIntegrated Brand MarketingPrintBrand AwarenessBrandingRelationship Marketingbrandingidentity marketingSalesMarketingBrandingIdentityate BrandingMultichannelAssist & Support administrative staff in their day to day working Assist & co- ordinate with sales & marketing teams Conduct market research . document & analyse reports Update internal databases as p...
missalesdata entrycustomer relationsmicrosoft excelmarket researchcommunication skillswritten communicationbasicenglishresearchmarketingdatabasescommunicationadministrationsalesmarketingPrimary ResearHandling sales, marketing and promotional activities there by achieving increased sales growth. - Developing relationships with distributors for business development. - Managing activities pertaining ...
salesmarketingcustomer relationsbasisdesignbusiness development operationsteam managementorder processingbuilding materialworking experiencesalesmarketingAREA SALES MANAGER Job Profile Area Sales Manager Apply Job For ! Job Summary DESCRIPTION Strong Experience in sales & distribution Translating annual sales into quarterly and monthly Setting sales ta...
salesmarketingtargetretailbusiness developmentstatements of workcost center accountingprogram management skillssystem integration testingstatements of work sowsalesmarketingsalesdistributionJob Profile Financial Controller/ Legal Entity Controller Apply Job For ! Job Summary DESCRIPTION: Degree qualification in either Accounting / Finance or Experience in technology and enhancement o...
statements of workcost center accountingprogram management skillssystem integration testingsap simple financearea salessap financestatements of work sowsalesmarketingsalesdistributionSales & Marketing Executives Locations - Pune, Ahmedabad, Baroda, Surat, Vapi, Aurangabad Positions - 2 Positions Each locations Qualification - Post Graduation Min 6 months experience,...
lessmarketinggraduatesalessalesmarketingqualificationsuratpunegraduationPosition Type : Full time Type Of Hire : Experienced (relevant combo of work and education) Education Desired : Bachelor of Commerce/Business Travel Percentage : <...
call center operationsback office managementcontinuous improvement facilitationback officeservice deskstandard workcontact centeronline privacysolution designsalesmarketingmediaentertainmentcall centerChennai , Bangalore , Mumbai , Hyderabad , Ahmedabad , Indore , Lucknow kolkatta , Gujrat and Delhi Company Name Client Of Wruksham Experience Minimum 4 years in Sales and Marketing Qualification Post...
targetpayment collectionpromotionsmarketingbrand managementdealersales targetsterritdistributsalesmarketingWhere you fit in Sales of cloud based POS software to restaurants,cafes,bakery and ice creams parlours. Gather sales leads from the market and approach restaurants actively, from no star to 5 stars,...
salesmarketingtargetbusiness developmentinsurancesales leadsaccount managementsales presentationscommunication skillsposicefitcloudbranddemosidealbakerycreamssellingsalesmarketingGraduate proficiency in english having minimum 10 years of experience in Sales Marketing in real estate industry in India, preferably from housing sector may contact us. Scouting prospective custom...
new projectssales strategymarket intelligencebusiness developmentfinding opportunitiessalesenglishoutlookhousingbusinessstrategylaunchesmarketingenquiriesmanagementsalesmarketingnegotiatioEaton India Innovation Centre: Eaton India Innovation Center (EIIC) in Pune, is an integral part of Eaton s global engineering and technology footprint and house one third of Eaton s i...
mechanicalsafetymachineryhvacplumbingboard of directorssupply chain managementcontinuous improvement facilitationlife cyclesupply chainhuman rightssalesmarketingThe Business Development (BD) unit, which sits within the Commercial, Corporate and Institutional Banking (CCIB) division, is looking to hire a CRM Product Owner to join a newly established programmme...
scrumagileproduct managementmarketingdeliveryprinter fleet managementenvironmental impact assessmentcustomer relationship managementstatements of work sowsalesmarketingAbout Quess : We are Indias leading business services provider, leveraging our extensive domain knowledge and future-ready digital platforms to drive client productivity through outsourced solutions. ...
networkingautomationcustomer relationsagileafter sales servicewinning others overibm rational rhapsodyback office operationscontinuous improvement facilitationsalesmarketingJob functions area : Marketing / Branding / Promotions Location : Vadodara Experience : 2 - 5 years Skills : DISTRIBUTOR, BUS...
lead generationbusiness analysismarketing strategybusiness developmentmarketingIntegrated Brand MarketingPrintBrand AwarenessBrandingbrandingidentity marketingSalesMarketingJob functions area : Marketing / Branding / Promotions Location : Vadodara Experience : 2 - 5 years Skills : BUSINESS DEVELOP...
lead generationbusiness analysisbusiness developmentbusinessanalysismarketingIntegrated Brand MarketingPrintBrand AwarenessBrandingbrandingidentity marketingSalesMarketing-Selling skills and convincing skills. -Negotiation skills to close sales deal. -Confident and Persuasiveness -Good learning ability. -Basic Computer knowledge Salary 2 Lac To 2 Lac 75 Thousand P...
salesmarketingtargetbusiness developmentinsuranceretail salesinstitutional salesretailsalaryinstitutionalDriving ResultsShrinkagesalesmarketingmarketing salesNew Ste OpeningsExcellent communication is required. Candidate should be able to manage a team. Candidate should have excellent knowledge & command on Branding, Sales & Marketing strategies. Candidate should be ab...
salesmarketingbusiness developmentcustomer relationstargetsalarycommandbusinessliasoningcommunicationIntegrated Brand MarketingPrintBrand AwarenessBrandingbrandingidentity marketingsalesmarketingSaleRole: As a full stack engineer, you will be working on both our back-end and front-end deployments. Initially, you will be responsible for improving existing pieces of our product and infrastructure....
javascriptcssjqueryhtmlmysqlmutual fundsmarket sharevisual designfinancial dataequity researchdata processingagile developmentsalesmarketingPosition Type : Full time Type Of Hire : Experienced (relevant combo of work and education) Education Desired : Bachelor of Computer Science Travel Percentage : call center operationsback office managementcontinuous improvement facilitationback officeservice deskstandard workcontact centersalesmarketingmediaentertainmentcall center
Job Purpose Business Development Manager The purpose of this job is to recruit quality advisors (free lancer) & support / train them to enable them procure insurance policies from the market & subs...
salesmarketingbusiness developmentcustomer relationstargeton thetrainingsetsalarytrainingbusinessinsurancelicensingincentivesperformancepersistencyTrain the Trainer ProgramssalesmarketingTrain the© 2019 Hireejobs All Rights Reserved