software qa tools jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

software qa tools Job Openings

Showing 42051 - 42100 of 52069 Jobs

Civil Technician

MILLENNIUM BABYCARES PRIVATE LIMITED 10.00 to 14.00 Years Chennai 01 Apr, 2024

tools

engineering

geotechnical engineering

design

walls

transportation engineering

data

collection

environmental engineering

Branch Operations Manager

BETTER HIRE 6.00 to 7.00 Years Chennai 01 Apr, 2024

A Branch Operations Manager isresponsible for the entire operation of a branch; from ensuring the attainment of sales goals to overseeing everyone provides excellent customer service. Bra...
business planningoperations team handlingoperations managementoperating systemsoperational excellence

Senior Study Abroad Advisor
IRISH EXPERT LLP 1.00 to 6.00 Years Bangalore 01 Apr, 2024

Senior Study Abroad Advisor
Role Summary The Senior Study Abroad Advisor takes on a leadership role in guiding students and professionals through the process of studyin...
overseas educationservice sales

Data Analyst (Power BI, Python, SQL)- Internal Audit domain, Bangalore
Talent Leads HR Solutions Pvt Ltd 3.00 to 8.00 Years Bangalore 01 Apr, 2024

Qualification- Mba Finance / Mca Experience 3 years Location Bangalore BO. 5.5 Days working from Office Key responsib...
sqlpowerdata analysisdatapython

Product Owner Busines Analyst
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 6.00 to 11.00 Years Bangalore 01 Apr, 2024

Required Product Owner: 4 years of product owner / business analyst / product management or related experience Business Analysis: 0-3 years of product owner / business analyst / product managem...
use casesdevopsazureagile project managementagile developmenttest case matrixazdo

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 15.00 to 25.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Maintenance Engineer
KINAL GLOBAL CARE PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 01 Apr, 2024

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Marketing Manager
MILLENNIUM BABYCARES PRIVATE LIMITED 13.00 to 23.00 Years Bangalore 01 Apr, 2024

An Email Marketing Manager utilizes email communication tools to market a company and increase brand awareness. They are experts in the usage of email communications and develop marketing strateg...
marketservicemarketinganalyticscampaignspowerpointcustomerresearchmanagementdigitalprojectntegratedstrong

CNC Machines
Future Solution Centre 8.00 to 13.00 Years Bangalore 01 Apr, 2024

CNC machines are computer-controlled machines used for manufacturing. Welder/machinists use these machines to fabricate mechanical components, construct wooden mock-ups, and machine specialty pa...
analyticalcncmachinistmathematical

SRE Lead .
LTIMindtree Limited 8.00 to 13.00 Years Bangalore 01 Apr, 2024

We are hiring for the position of SRE Lead with SDLC experience, Devopsat LTI Mindtree Job Title:-SRE Lead Skills : -SDLC experience, Devops Exp : - <...
capacity planningsoftware development life cyclereliability engineeringshell scriptingsite engineeringdevopssoftware deployment

Senior Azure Engineer
LTIMindtree Limited 8.00 to 12.00 Years Bangalore 01 Apr, 2024

We are hiring for the position ofSenior Azure Engineer at LTI Mindtree Responsibilities

Design and develop Infrastructure as code to deploy Azure r...
azurekubernetessqldevops

Site Supervisor & Site Engineer (Civil & Mechanical)
The JSM Engineers 0.00 to 2.00 Years Bangalore 01 Apr, 2024

Job Details

Required Qualification: Dipl/Deg in Mechanical/Civil

Required Location: Hazira, Jamnagar, Pune, Dahej, Bangalore

Required Experience: 0...
siteconstruction safetysite managementsite supervisionsite engineeringcivil engineeringsite executionmechanical engineering

Graphic Designer
EduGATE Engineering Academy 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

About us: EduGATE Engineering Academy EduGATE Engineering Academy is a leading GATE coaching institute of Gujarat founded by IIT Bombay alumni in 2013. Institute has trained more than 12000 stu...
Graphic DesignVideo ProductionVideo EditingContent CreationInnovation

Lead - Talent Management
Adani Group 15.00 to 19.00 Years Ahmedabad 01 Apr, 2024

Purpose of the role:- Reporting to the Group Head, Talent and Leadership Development, the Succession Planning & Assessment Leader will be responsible for developing a pipeline of ready-to-deploy,...
Succession PlanningTalent ManagementLeadership DevelopmentOrganizational PsychologyChange ManagementTalent Assessment

Urgent Hiring for Site Engineer
Manpower Solution Fresher Ahmedabad 01 Apr, 2024

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management

Junior Flutter & React Native Developer
Technoville Consultants 0.00 to 4.00 Years Ahmedabad 01 Apr, 2024

We are looking for a talented Mobile App Developer Intern to join our team and help us build amazing mobile applications for our users. Responsibilities: Work closely with our development and de...
AndroidiOSCommunication SkillsInterpersonal SkillsSDLCAgile MethodologiesMobile App DevelopmentUIUX DesignProblemsolvingReact Native

Junior Embedded Hardware Engineer
Bioscan Research 1.00 to 5.00 Years Ahmedabad 01 Apr, 2024

Company Description Bioscan Research is focused on improving traumatic brain injury patient outcomes through early detection using the CEREBO, a machine learning-powered NIRS device. The company ...
Circuit DesignEmbedded Software DevelopmentSchematic CaptureI2CUARTEthernetSoftware Development MethodologiesSignal ProcessingMachine LearningElectronics Hardware DevelopmentEmbedded Systems DesignMicrocontrollerMicroprocessor ArchitectureReal

Sr. Hardware Engineer
Electrify Services 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Position Title: Hardware Engineer Full Time Electrify Services is one of the fastest-growing engineering services start-ups and is looking for a Sr. Hardware Engineer to play a key role in helpi...
RS485SPIUSBCANZigBeeWiFiGPSGSMWiFiBluetoothSD CardcameraLCDSystem integrationCommunication systemsTeam leadershipHighfrequency electronic circuitsEmbedded hardware products designMixed signal circuit designLowpower circuit designHig

Electronics Hardware Engineer
Multispan Control Instruments 1.00 to 4.00 Years Ahmedabad 01 Apr, 2024

Job Description We are seeking an experienced Electronics Hardware Engineer to join our team. The ideal candidate will have a strong understanding of electronics hardware design and a passion for...
Electronics hardware designAnalogdigital circuit designPrototype testinganalysisComponent sourcingEmbedded systems firmware programmingDevelopment of production test specificationsPreparation of bills of materialsPCB layout

Talent Acquisition Manager
Bethel Group 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Bethel Group is looking to hire for a *Talent Acquisition Manager* role for one of the leading luxury automobile brand. Job Location - Ahmedabad, Gujarat Budget - Upto 11 lpa Responsibilities: ...
Talent AcquisitionRecruitmentManpower PlanningSuccession PlanningSourcingInterviewingCandidate AssessmentCommunication SkillsNegotiation SkillsInterpersonal SkillsTeam HandlingTalent Pipeline ManagementRecruitment Process ImprovementIndustry

Corporate Sales Executive in Ahmedabad
BDNT Labs Private Limited 5.00 to 9.00 Years Ahmedabad 01 Apr, 2024

Key Responsibilities Create a network strategy plan to secure an adequate dealer footprint for current and future business including investment request and involve feasibility study Look for new...
Business PlanningProject ManagementDealer ManagementMarket ExpansionNetwork Strategy PlanningFeasibility StudyCustomer Satisfaction ManagementGlobal Team CollaborationFacilities Standardization

Hardware Engineer
VMukti Solutions 2.00 to 6.00 Years Ahmedabad 01 Apr, 2024

Hardware Engineer No. of Openings : 1 Experience Required : 2 year Location : Ahmedabad Education Qualification: Any technical Graduate/Post Graduate (Graduate from EC & IC is preferred) Key Ski...
Knowledge of CCTV HardwarePCBsKnowledge of RepairAssembly activity of HardwareUnderstanding of Technical toolsPCB layoutsDrawingsDesignsKnowledge of Firmware

Graphic Designer
Saathi 2.00 to 4.00 Years Ahmedabad 01 Apr, 2024

As a Graphic Designer at Saathi you will be responsible for the entire process of defining requirements, visualizing and creating graphics including illustrations, photoshops logos, layouts and ...
Analytical SkillsCreativityGraphic Design SoftwareCommunication SkillsPhotoShopIllustratorGraphic Design SkillsLayout SkillsFlexibilityAttention to DetailDeadlineorientedDesktop Publishing ToolsAcute VisionTimemanagement SkillsHandles Reject

Assistant Manager Business Development
Unison Globus 3.00 to 7.00 Years Ahmedabad 01 Apr, 2024

Company Description Unison Globus is a Florida-based company that has been catering to the needs of CPAs, EA, and Accounting professionals in North America, Australia, New Zealand, and Singapore ...
Business DevelopmentSalesClient Relationship ManagementAccount ManagementCommunicationInterpersonal SkillsAnalytical SkillsMicrosoft OfficeProblemSolving SkillsFinancial KnowledgeAccounting KnowledgeTax Preparation Services

Banking Assistant
Gupta Trading & Financial Services 2.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

We are looking for a client-oriented banker to join our banking team. Your responsibilities will include working closely with clients to determine their banking needs, including discussing their ...
customer servicebankingback office operationsaccount managementoffice administrationfront officedata entry

Telesales/telemarketing Executive
MASTER SOLUTIONS 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

This is a full-time on-site role for a Call Center Representative work location based in Sri Lanka The Call Center Representative will be responsible for handling customer inquir...
telecallingbpo voicecustomer relationshipoutbound salessalestelesalesoutbound tellecalling

Data Entry Operator, Work From Home, Part Time
LAXMI TECHNOLOGY 1.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Greetings, We AreGovt. Reg. AndGenuine Data Entry service provider, In All over India. For more details Contact Our Project Manager90hidden_mobil...
excelfreelance writingwork from home typingdata entry operationfreelance typingmanualfreelance editing

Hiring Sap mm functional consultant for multiple cities
V tech it solutions 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

Dear Candidates, We have a requirement for SAP MM Consultants to our reputed MNC Client. Positions - 06 Exp - 0 to 3 years. Qualifications - BE ME, Mtech, BE EC, BE CIVIL, BE IS, MBA, BCOM, B...
procurement managementmm moduledistribution solutionslogistics consultingvendor masterlogistics designstoreslogistics management

Call Center Executive
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vishakhapatnam 30 Mar, 2024

As a Call Center Executive, you will be the frontline representative of our company, responsible for handling incoming and outgoing calls from customers or clients. Your primary objective is to p...
call auditcall center operationscall monitoringcall quality

Textiles Assessor- Freelance Parttime Urgent
Innocox Consulting and Research Pvt Ltd 2.00 to 7.00 Years Vishakhapatnam 30 Mar, 2024

Job description Job Title: Assessor for Textiles Industry(Textiles Assessor- Freelance/Part time) Location: PAN India

Job T...
handicraftappareltechnical textileshandicraftsskill developmenttextile industryassessmentgarment manufacturingsamarth

Textile Assessor
I-Vintage Solutions Pvt Ltd 2.00 to 5.00 Years Vishakhapatnam 30 Mar, 2024

Job Title: Textile Assessor Location:Karnataka, TamilNadu, Kerala, Andhra Pradesh, Telangana Job Type: [Part-time/Contract] ...
textile designingfashion designingapparel merchandisingprocessingcarpet designing

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vishakhapatnam 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Work From Home, Data Entry Operator
Learning Planner 0.00 to 2.00 Years Vijayawada 30 Mar, 2024

We have various types of online and offline project works. We have an urgent requirement of Work From Home, Data Entry Operator who is dedicated and serious about his work. Responsibili...
typing speedwork from homedata entry

WFH | Data Entry Typing
Fondstaff Private Limited 0.00 to 3.00 Years Vijayawada 30 Mar, 2024

We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We have various types of online and offline project works. Responsibil...
smswork from home typingpart time work from homework from homepart time freelanceback officeonline data entryonline work from homecomputer operator

Call Center Executive
Prime Placement Vision Pvt Ltd 0.00 to 4.00 Years Vijayawada 30 Mar, 2024

As a Call Center Executive, you will be the frontline representative of our company, responsible for handling incoming and outgoing calls from customers or clients. Your primary objective is to p...
call auditcall center operationscall monitoringcall quality

Data Entry Typing (Work From Home )
Learning Planner 0.00 to 1.00 Years Vellore 30 Mar, 2024

We are in urgent need of Data EntryTyping(Work From Home Jobs) who is dedicated and serious about his/her work. We have various types of online and offline project works. Responsibiliti...
typing speeddata entry operationms exceltypingms wordwork from home

Aircraft Maintenance Engineer Opening
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
aerodynamicstechnical writingaerospace engineeringcreativity skills

Quality Control Specialist
Lakshman Kumar Hiring For Lakshman Enterprise 1.00 to 6.00 Years Vellore 30 Mar, 2024

We are looking for a detail-oriented quality assurance specialist to be in charge of all quality assurance activities. Responsibilities Preparing and implementing quality assurance policies and...
quality controlquality auditingquality management

Hiring For Application Support Engineer
RENUKA INTERPRISES 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are seeking a knowledgeable application support engineer to monitor and maintain the efficiency of our software applications. In this role, your duties will include reporting to our senior sof...
pythonanalyticssqlprogramming

Hiring For Software Developer
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

Our company is seeking to hire a skilled software developer to help with the development of our current projects. Your duties will primarily revolve around building software by writing code, as w...
pythondatabasesoftware developmentcomputer science

Hiring For QA Tester
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are looking for a dedicated QA tester to be responsible for designing and implementing test plans to improve the usability of our products. The QA tester works with the development team to deb...
sqlcomputer sciencejava

Hiring For Business Analyst
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
project managementbusiness processsoftware testingdata analytics

Data Scientist Vacancy
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are looking to hire a highly creative data scientist to address data analytics challenges in our organization, to collect large volumes of data from varying sources, clean and interpret data, ...
analysisanalyticssqlpython

Business Analyst Opening
Divya Staffing Solution 0.00 to 4.00 Years Vellore 30 Mar, 2024

We are hiring a business analyst to join our project team. You will work alongside other business analysts and report directly to the project manager. Your main tasks will include performing deta...
business processdata analyticssoftware testingproject management

Assistant Manager
Contrywide 3.00 to 5.00 Years Varanasi 30 Mar, 2024

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for an Assistant Manager located in Varanasi. The Assistant Manager will be responsible ...
CommunicationInterpersonal skillsCritical thinkingMicrosoft OfficeProject managementTeam managementCollaborationStrong leadershipProblemsolvingDecisionmakingOrganizational skills

Marketing Manager
IMS Learning Resources Pvt Ltd 3.00 to 7.00 Years Varanasi 30 Mar, 2024

Company Description IMS Learning Resources Pvt. Ltd. is a pioneering institution in management education training in India. Established in 1977, IMS has expanded into various sectors, providing t...
Market researchAnalytical skillsCommunication skillsProject managementDigital marketingMarketing strategiesProblemsolving skills

Aircraft Maintenance Engineer Vacancy
Divya Staffing Solution 0.00 to 4.00 Years Varanasi 30 Mar, 2024

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
maintenancecustomer servicehand toolsaircrafts

Customer Support Specialist
Pioneer Placement Services 0.00 to 4.00 Years Varanasi 30 Mar, 2024

International BPO - Customer Service or Technical Support Job Location - Jaipur & Gurgaon (Work From Office)

Respon...
voice processcommunication skillschat processbpocustomer serviceinternational processcustomer carecall center operations

Maintenance Technician
Mohinder Singh Hiring For Farm 1.00 to 6.00 Years Varanasi 30 Mar, 2024

Establishing and maintaining communication with the project team, management and stakeholders Coordinating project meetings and decision-making processes Executing the work, coordinating and supe...
project coordinationdocumentationquality controlprocess qualityquality managementoperations managementteam leadershipmaintenance engineering

Project Manager
MMK ENTERPRISES 5.00 to 10.00 Years Vadodara 30 Mar, 2024

Employment Nature :1 Years Extendable ON MMK Enterprises payroll.www.kushalengineers.com Location :Vadodara Designation : commissioninginstallation

PREV
NEXT

software qa tools Job Openings

Senior Study Abroad Advisor

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above; Minimum 8 years of experience in oil and ga... hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi... construction site managementsite executionsite supervisionsite coordinationsite management

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
maximoschedulingmaterial managementpackaginghydraulicsinstrumentationorder managementms projectutility maintenance

Job description

bachelors degree in engineering preferably in Mechanical, Electrical or Instrumentation with CGPA 7.0 or above;

Minimum 8 years of experience in oil and ga...
hydraulicsms projectmaximomaterial managementschedulingorder managementpackagingplant maintenanceinstrumentation

Site Engineer Job Description We are looking for a well-organized site engineer with strong leadership skills to join our growi...
construction site managementsite executionsite supervisionsite coordinationsite management