source potential candidates jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

source potential candidates Job Openings

Showing 20451 - 20500 of 56342 Jobs

Urgent | Hiring SME(Ticketing) & SME (Sales) in Delhi & Gurugram

Sharda Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

subject matter expertise

Mechanical Supervisor

Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

machine shop

machine assembly

quality engineering

mechanical maintenance

mechanical engineering

assembly shop

process inspection

production engineering

Senior Quality Engineer

Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Manesar, Kundli 01 Apr, 2025

mechanical engineering

audit documentation

production planning control

new product development

production engineering

quality control

thermoforming

production scheduling

Sr.Finance Manager

Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group)

About Us:-

stakeholder management

erp software

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )

Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Purchase Manager - Male

Location:

Job Responsibilities :-

Relationship Manager

CAREER AHEAD 1.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Mechanical Engineer Fresher
Sanskar HR Consultancy Services Hiring For Manufacturing Industry 0.00 to 1.00 Years Gurugram,Noida 01 Apr, 2025

Urgent Hiring for B.tech/Diploma Mechanical Engineer Job Description Total Vacancies: - 60 Dear Candidates Your Resume Is Shortlisted for Automobile & Manufa...
qualitydiplomamechanicalproductionmaintenance

Business Development Manager
KKD Consulting Hiring For Clients 2.00 to 7.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Panchkula, Mohali, Chandigarh, Mumbai City 01 Apr, 2025

KKD IS HIRING Job Title: Sales Manager - Agency Channel Company Overview: Join , a leading firm committed to innovation and excellence. Were ...
salesoutside sales

Data Entry from home - No Experience Needed
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear candidate, We are seeking a meticulous Data Typing Specialist to join our team. Skills Needed: Basic computer knowledge Work Conditions: No age bar, no work pressure, no targets. Both ma...
data entryexcelback office

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Openings for Life Insurance Sector- Delhi location (CTC up to 5 LPA)
ATS Infovision 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. : hidden_mobile or just a message on whatsapp with Yes to get a call back <...
direct salesinsurancecasa salesbankingfield workdirect channel saleslife insurancedirect marketing

Tele Caller
Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title: Tele caller Location:Gurgaon Experience: 0-2...
bpolead generationcustomer relationship

Lead Generation Expert
Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: Lead Generation Expert Location: Gurgaon Job Summary: We are looking for a proactive and results-driven Lead Generation Expert to ...
voice processinternational call centertelecom salesinternational salesinternational bpoverizonatnt

Materials Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

We are searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge of inventory mana...
inventory managementmaterials managementmaterial procurementsourcing strategylogistics managementmanufacturingpurchase managementprocurement

Urgent Hiring For the Position of Relationship Manager and Sales Officer
DREAMS SOLUTIONS 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates Greeting For a day ! We have job opening in Banking Sector for the profile of # Relationship Manager personal loanscasa sales

TGT Fine Arts
Educare Ventures Private Limited 2.00 to 7.00 Years Gurugram 01 Apr, 2025

Excellent opportunity as TGT - FINE ARTS from a well reputed CBSE affiliated school located near to South City-II, Gurgaon. Position: TGT - FINE ARTS fine arttgt fine arts

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Data Entry Operator-Work From Home-Computer Work-Typing Work Fresher (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, were seeking a skilled data entry operator to join our data team. In this role, youll manage essential data input tasks, such as ensuring data accura...
work from homeback officefreelancingdata entrypart timehome based data entrytypingstudentsfresher

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Part Time-Work From Home-Freelancing Computer-Data Entry Operator (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary on our company databases and computer systems. Data Entry Operator responsibilities include collecting a...
freelancingcomputer operatingdata entrypart timedata managementhomehome basedfresherfromwork

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Urgent Vacancy For Data Entry Operator (Work From Home)
MATTRIXX INDIA 0.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Vishakhapatnam, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are looking for candidates who are self- motivated and willing to work from home and have passion in Data Entry. We offer various types of data entries work: Excel Numeric ...
typing 40wpmdata entrytyping speedwork from homedata entry work from homedata entry operation

Customer Care Executive
Elevate X solutions 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Job Title Customer Care Executive Location Gurgaon Salary: 15,000 - 25,000 per month Job Description We are seeking enthusiastic Customer Care Executives for our BPO operations in Gurgaon. Res...
time managementcareer counsellingproblem solvingcustomer careexcel

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Internship Trainee
Quess Corp (Magna Infotech) Fresher Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Empower Her Exclusive Internship Program for Women Quess Corp is excited to launch Empower Her , an...
it staffinghr operations

Material Management Executive
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 19.00 Years Thiruvanananthapuram,Other Maharashtra, Bangalore, Chennai, Other Tamil Nadu, Hyderabad, Kolkata, Mu 01 Apr, 2025

Our growing business is searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge ...
supply chain managementlogistics coordinationpurchase orderscontinuous improvementmaterial planning

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

for Sales Warrior & Relationship Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Other Kerala,Chennai, Other Tamil Nadu 01 Apr, 2025

JobDescription Direct Marketing Channel Designation: Sr. Relationship Manager/Executive Relationship Manager Roles & Responsibilities...
agency channelsalesinsurance salesmarketingbusinessagency

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

Coordinator Backend office work, Home based work
Divine HR Services 0.00 to 1.00 Years Ernakulam,Bangalore, Madurai, Chennai, Hyderabad, Other Madhya Pradesh, Kanyakumari, Pondicherry, Th 01 Apr, 2025

Job Description Dear candidate, Home Based Job& Limited Vacancy Apply Now. J P G TO MS-WORD Data Typing work simply data entry job. Our company hiring every month fresher for typingback officeenglish typingenglish writingback office operationspart timedata entrycomputer operating

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Chennai, Hyderabad, Vishakhapatnam, Kolkata, Pune, Chandigarh, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Data Entry Clerk
V-Tech Data Outsourcing 0.00 to 1.00 Years Ernakulam,Pala, Thiruvananthapuram, Kasaragod, Bangalore, Ramanathapuram, Chennai, Pudukottai, Kanya 01 Apr, 2025

This Job is seeking motivated and detail-oriented students for our Online Data Entry positions Work Arrangement : Work From Home Skills: The ideal cand...
typingwork from home content writingdata entrywork from home typingexcel sheetwork from homedata analytics

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Floorman vacancy
Apex Offshore Services 0.00 to 1.00 Years Ernakulam,Idukki, Kochi, Kozhikode, Palakkad, Thrissur, Other Madhya Pradesh, Vishakhapatnam, Kakina 01 Apr, 2025

Greeting Walk-in Interview starts in Mumbai we are hiring for the position of Floormanwith a leading Oil & Gas Industry Job Responsi...
gasdrillingoffshore platformsoildiploma in drilling engineer

Territory Sales Manager
Linways Technologies 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Kochi, Kerala Work Type: Full Time Location : Mangalore, India(Candidates who are willing to relocate can apply) B2B Corporate Sales Aggressively use phone, emails and other sales & marketing t...
Sales PresentationsCRM ManagementB2B Corporate SalesSalesMarketing

Junior IoT Hardware and Firsm ware Developer @Amritapuri
Amrita Vishwa Vidyapeetham 2.00 to 6.00 Years Kollam,Other Kerala 01 Apr, 2025

Job Title Junior IoT Hardware And Firsm ware Developer Required Number 1 Qualification B.Tech, Good to have M.Tech but not a must to have requirement Job Description Tranquility IoT & Big Data Sol...
Electronics design skillsknowledgeKnowhow of embedded codingAbility to think out of the box

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Operation Manager
digibiz build on quality rating pvt ltd 5.00 to 9.00 Years Kozhikode,Other Kerala 01 Apr, 2025

1. Project Management: - Plan, organize, and execute construction projects from initiation to completion. - Coordinate with District managers to ensure timely delivery within budgetary constrain...
Project ManagementResource ManagementQuality AssuranceTeam Leadership

PREV
NEXT

source potential candidates Job Openings

Key Responsibilities: field salesgold valuationgold loan operationsgold loanbfsi salesrelationship managerrelationship officersales manager

About Us:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers