understanding of relevant laws jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

understanding of relevant laws Job Openings

Showing 35401 - 35450 of 59179 Jobs

Alert Hiring Urgent requirement Agency Sales ( Life Insurance)

Niyukti Management Consultants Hiring For None 3.00 to 8.00 Years Bhubaneswar,Kolkata, Gurugram, Patiala, Amritsar, Jalandhar, Ludhiana, Chandigarh, Delhi, Guwahati 12 Nov, 2024

agency development manager

business development manager

sal

Process Executive

MAGNETTZ (OPC) PRIVATE LIMITED 2.00 to 7.00 Years Bhubaneswar,Sambalpur, Gaya, Bhagalpur, Kolkata, Other West Bengal, Asansol, Patna, Dibrugarh, Guwah 12 Nov, 2024

Key responsibilities: home loanslap

Salesforce Technical Lead - Apex/Visual Force
Teqfocus 7.00 to 11.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

Overview We are looking for an experienced and dynamic Salesforce Technical Lead with 7 years of hands-on expertise in Salesforce development and architecture. In this role, you will lead the end...
VisualforceRESTSOAPMulesoftContinuous integrationApexLightning Web Components LWCSalesforce integrationsAPI integration toolsSalesforce Sales CloudService CloudExperience CloudSalesforce certificationsDevOps processesContinuous deployment

Legal advice
Confidential 3.00 to 7.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

legal advisors job description includes:Legal research: Conducting research on legal issues that affect clients or organizations, including relevant laws, regulations, and policies Legal complianc...
Communication skillsAnalytical skillsNegotiation skillsAttention to detail

Mutual Fund Operations Manager
VCap Money 1.00 to 5.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

Company Description VCap Money, located in Ranchi, is a client-focused wealth management firm with a diversified client base. We provide expertise in investing, planning, protecting, and advisory...
Investment StrategiesClient CoordinationPortfolio ManagementMicrosoft ExcelMutual Fund OperationsAUM GrowthEquity TransactionsCompliance Standards

Mobile Application Developer
Raneso 2.00 to 6.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

About The Company Raneso is a software company specializing in the creation of custom IT solutions for web, mobile, and desktop. We offer visually engaging and user-centric interactive solutions...
RESTful APIsWebSocketsGitBitbucketFirebaseAWSautomated testingcontinuous integrationFlutterDart programmingCICDGraphQLAndroid design principles

Asst. Manager Finance
Marriott International, Inc 0.00 to 3.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

JOB SUMMARY Supports the day-to-day execution of general ledger impacted processes, including support to clients as they work with and understand these processes. Performs accounting functions sp...
AccountingFinanceReportingDiscrepancy ResolutionCredit Card ReconciliationFinancial ReportingBudgetingFinancial ControlTax ComplianceFinancial AnalysisCustomer ServiceEmployee TrainingMentoringCoachingConflict ManagementTime ManagementProb

Data Entry Operator Computer Operator Work From Home
Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Ranchi,Patna, Jaipur, Indore, Raipur, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Guwaha 12 Nov, 2024

Learning Planneris seeking enthusiastic individuals to join our team asData Entry Executivesfor remote work. This is an excellent opportunity for housewives, ret...
work from home typingwork from homedata entrydata entry typingback office operationsback officehome based data entrydata entry work from home

Lab Manager
General Diagnostics International (P) Ltd 10.00 to 14.00 Years Ranchi,Other Jharkhand 12 Nov, 2024

Job Summary: The Lab Manager will oversee the laboratory operations, ensuring quality control, adherence to protocols, and the smooth functioning of lab activities. This role involves managing la...
LeadershipCommunicationTeamworkOrganizational skillsAnalytical abilitiesAttention to detailLaboratory information management systems LIMS

Cargo Manager
Prime Placement Vision Hiring For Prime Placement Vision Private Limited 0.00 to 4.00 Years Ranchi,Jaipur, Other Maharashtra, Other Odisha, Other Madhya Pradesh, Other Rajasthan, Udaipur, Pune 12 Nov, 2024

The Cargo Manager plays a crucial role in overseeing the efficient handling, storage, and distribution of goods within a transportation or logistics company. They are responsible for managing all...
cargo managementcargo planningcargo operationscargo handling

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ranchi,Patna, Indore, Ahmedabad 12 Nov, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Financial Market Analyst/Equity Research Analyst.
Real Ispat & Power 2.00 to 6.00 Years Raipur 12 Nov, 2024

Raipur Chhattisgarh | Relevant Experience 2 years to 5 years | MBA Finance/Chartered Accountant | Responsible for Equity Research, Financial Analysis of Companies, Report Writing, Preparing Compan...
Equity ResearchFinancial AnalysisReport WritingMBA FinanceChartered AccountantPreparing Company Pitches

Site Engineers- Piping/Electrical/Instrumentation (Food/Pharma-API projects)
BioTalent Search Private Limited 7.00 to 11.00 Years Raipur 12 Nov, 2024

We are looking for site engineers to manage pharma projects, with multiple roles available as per the job descriptions (JDs) below, for Raipur location. 1) Job Title: Piping Site Engineer Locati...
project managementequipment maintenanceAutoCADMS Officesite construction supervisionFoodPharmaAPI manufacturing sitespiping systems

Area Head- SME
shriram finance limited 5.00 to 9.00 Years Raipur 12 Nov, 2024

Skills: Business Loans, sales, business development, collection, secured & unsecured loan, Job Description Guide distribution of Business Loan ensuring volume scale-up. Take up all business loa...
Business Loanssalesbusiness developmentcollection

Chemical Specialist
bhuranichem industries 0.00 to 4.00 Years Raipur 12 Nov, 2024

Company Description we suggest you enter details here Role Description This is a full-time Chemical Specialist role at Bhuranichem Industries in Raipur, with flexibility for some remote work. A...
ChemistryChemical EngineeringChemical AnalysisResearchDevelopmentAnalytical SkillsCommunicationTeamworkLaboratory ProceduresSafety Protocols

Senior Operations Manager
Infiniti Salon unisex studio 5.00 to 9.00 Years Raipur 12 Nov, 2024

Company Description we suggest you enter details here Role Description Qualifications Proven experience in operations management Strong leadership and organizational skills Excellent communi...
Operations ManagementLeadershipCommunicationBeauty IndustryOrganizational SkillsInterpersonal AbilitiesProblemsolvingDecisionmaking

Senior HR Executive
Shri Ram Enterprises 1.00 to 5.00 Years Raipur 12 Nov, 2024

The Human Resource Executive is responsible for supporting various human resource functions and initiatives within the organization They will assist in recruitment and selection, employee onboard...
RecruitmentSelectionEmployee OnboardingBenefits AdministrationEmployee RelationsPerformance ManagementHR ComplianceBenefits AdministrationEmployee DevelopmentEmployee RelationsTrainingDevelopmentRegulationsMaintain Employee RecordsHR Databas

Data Entry Operator Computer Operator Work From Home
Learning Planner Hiring For Data Entry, Back Office, Work From Home 0.00 to 4.00 Years Raipur,Jaipur, Indore, Other Madhya Pradesh, Thiruvanananthapuram, Chandigarh, Ranchi, Patna, Guwaha 12 Nov, 2024

Learning Planneris seeking enthusiastic individuals to join our team asData Entry Executivesfor remote work. This is an excellent opportunity for housewives, ret...
work from home typingwork from homedata entrydata entry typingback office operationsback officehome based data entrydata entry work from home

Front Office Associate
M/S LANDCRAFT RECREATIONS PRIVATE LIMITED 5.00 to 8.00 Years Raipur,Armenia, China, Congo, Qatar, Patna, Saudi Arabia, Zimbabwe, Ahmedabad, Bangalore, Kuwait, In 12 Nov, 2024

Job description A Front Office Associate assists in daily Front Office operations and works with customers and Guests to serve their needs and provide an excellent customer service experience. W...
receptioncustomer servicehospitalityguest serviceguest relationsrooms divisioncustomer relationsfront officeguest handling

Electrical Engineer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, Other A 12 Nov, 2024

We are looking for an electrical engineer who will help us advance our electrical products, systems, and applications. On a daily basis, youll carry out various engineering tasks, such as perfor...
physicsmathematicsskills.criticalthinking.

Engineering Technician
OVERNET TRADING PRIVATE LIMITED 19.00 to 25.00 Years Nagpur,Aurangabad, Kalyan, Navi Mumbai, Ahmednagar, Sangli, Jalgaon, North Goa, Mumbai City, Vasco D 12 Nov, 2024

We are searching for a driven, detail-orientated engineering technician to join our growing organization. The engineering technicians responsibilities include performing research, building protot...
compressionmaterialswelldrillingmanagementpipelineengineeringproductioncontrolsafetyprocessoperator/leaseplantscheduleroperatormechanictechnicianheadsr.engineerspec-response

Clinical Data Manager
Latisha Interprises 0.00 to 3.00 Years Nagpur,Wardha, Indore, Chennai, Kochi, United Arab Emirates, Jabalpur, Vijayawada, Vishakhapatnam, K 12 Nov, 2024

The ideal candidate should have extensive knowledge of the clinical data management principles, regulatory guidelines and industry best practices. They should be willing to work independently and...
analytical researchcracommunicationproject management

Electrical Engineer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Noida,China, Bangladesh, Other Bihar, Qatar, Other Goa, Other Arunachal Pradesh, South Korea, Other 12 Nov, 2024

We are looking for an electrical engineer who will help us advance our electrical products, systems, and applications. On a daily basis, youll carry out various engineering tasks, such as perfor...
physicsmathematicsskills.criticalthinking.

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Pune,Zimbabwe, Mozambique, Bangalore, Noida, Chennai, United Arab Emirates, Hyderabad, Kolkata, Guru 12 Nov, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Sales And Marketing Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Contributing to the development of marketing strategies.

Conducting market research on rival products.

Designing and implementing marketing plans for company products...
sales promotionbrandingsales managementpromotionsmarketing promotionsbrand promotion

Safety Officer
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Qatar, Other Bihar, Other Arunachal Pradesh, Other Assam, South Korea, Iraq, 12 Nov, 2024

We are seeking a responsible Safety Officer to ensure compliance with occupational health and safety (OHS) guidelines. Your primary role will be advising on measures to minimize hazards and maint...
risk managementsafety officer skills

Hotel Front Desk
AES INDUSTRIAL PRIVATE LIMITED 6.00 to 11.00 Years Pune,China, Bangladesh, Other Bihar, Qatar, Other Arunachal Pradesh, South Korea, Other Assam, Iraq, 12 Nov, 2024

We are looking for a Hotel Front Desk to serve as our guests first point of contact and manage all aspects of their accommodation. Hotel Front Desk Agent responsibilities include registering gue...
communication skillsfront desk reception

Assistant Manager
AES INDUSTRIAL PRIVATE LIMITED 5.00 to 10.00 Years Pune,China, Bangladesh, Qatar, South Africa, Port Blair, South Korea, Iraq, Bangalore, Sri Lanka, Ch 12 Nov, 2024

We are looking for a responsible Assistant Manager to help organize and run our retail stores and fill in for thewhen needed. Your job will be highly important in ensuring the sales team meets it...
assistant workmanager self-service

Automobile Sales Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Responsibilities

Build a rapport with potential customers to improve the possibility of a sale in the future

Maintain a customer database and communicate with them
<...
storesbusiness developmentretail salesinsurancechannel salescustomer servicecounter sales

HR Onboarding Manager
NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 24.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi, Itanagar 12 Nov, 2024

We are looking for an HR Onboarding Manager to oversee the procedures our company follows before and after hiring new employees. HR Onboarding Manager responsibilities include scheduling new hir...
conflict managementproject managementproblem solvingcommunicationcollaborationfacilitation facilitationonboarding managementhr policies compliance

Marketing Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Responsibilities

Conceive and develop efficient and intuitive marketing strategies

Organize and oversee advertising/communication campaigns (social media, TV etc.), ...
advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Pune,Bangalore, Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 12 Nov, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Pune,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Chennai, Noida, Hyderabad, Kolkata, Lebano 12 Nov, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Warehouse Staff Helper in Poland Work Visa
WORK IN DUBAI TRAVELS 0.00 to 2.00 Years Pune,Anantpur, Guntur, Bangalore, Chennai, Kurnool, Nellore, United Arab Emirates, Poland, Hyderabad 12 Nov, 2024

Warehouse Worker Job Description A Warehouse Worker isresponsible for various tasks related to receiving, storing, and shipping goods in a warehouse setting. Key responsibilities include:
...
unloadingpacking materialwarehouse lendingloadinghelper

Cargo Manager
Prime Placement Vision Hiring For Prime Placement Vision Private Limited 0.00 to 4.00 Years Pune,Other Maharashtra, Jaipur, Other Odisha, Other Madhya Pradesh, Other Rajasthan, Udaipur, Ranchi 12 Nov, 2024

The Cargo Manager plays a crucial role in overseeing the efficient handling, storage, and distribution of goods within a transportation or logistics company. They are responsible for managing all...
cargo managementcargo planningcargo operationscargo handling

Medical Coordinator
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Pune,Singapore, Zimbabwe, Mozambique, Afghanistan, Bangalore, Noida, Chennai, Hyderabad, Gurugram, K 12 Nov, 2024

We are searching for a medical coordinator to manage and maintain the smooth operations of our facilitys administration, scheduling, and patient admissions. In this role, you will be required to ...
officemdsmanagementsystemsfrontaccountingmedical billingseniorpurchasingwealthengineercoordinatoradministratormedicalassociateinformationconsultantvaluemanager

Counsellor
PROGENESIS IVF PRIVATE LIMITED 2.00 to 7.00 Years Pune,Nashik, Navi Mumbai, Mumbai City 12 Nov, 2024

Urgent requirement for the post of Counsellor for Mumbai, Pune, Nashik Location. Job Title:Counsellor Experience: 2 Years of Relevant Experien...
patient relationspatient carepatient counselinglead generationpatient counsellor

Site Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Site Management:

Oversee daily operations on the site, including work schedules, progress, and resource allocation.

Ensure all activities are co...
progress monitoringsite engineeringcivil constructionproject coordinationconstruction management

Hr Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Develop and implement HR strategies and initiatives aligned with the overall business strategy.

Manage recruitment and selection proces...
recruitmentjoining formalitiesattendance managementhr generalist activitiesoffer generation

Data Engineer
HIPAAS INFOTECH PRIVATE LIMITED 5.00 to 10.00 Years Pune,Thane 12 Nov, 2024

Key Responsibilities:

Deliverables:

o Document foundational data tables to establish a robust data architecture. o Migrate and validate test tables to en...
data modelingsnow flakepythonsqlaws

Director of Finance
ATOVITT SERVICES PRIVATE LIMITED 18.00 to 24.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi, Port Blair 12 Nov, 2024

We are looking for an experienced Director of Finance (Finance Director) to oversee all financial aspects of business and drive the companys financial strategy and planning. You ...
flowhyperionservicedataanalysisperformancebalancemanagementcashcustomerexecutivefinancialsheetinternal

collection manager
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 5.00 to 8.00 Years Pune 12 Nov, 2024

Team Management: Lead, mentor, and manage a team of collection agents responsible for personal loan collections. Ensure team members meet performance targets and follow the collection process ef...
collection manager

Senior Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 10.00 to 15.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

1. Strategic HR Leadership: Lead the development and implementation of HR strategies and initiatives that support the overall business objectives and drive organizational success. 2. Talent Acqu...
recruitment managementtalent engagementemployee engagementrecruitmentwelfare managementlearning development

Civil Project Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 7.00 to 12.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Work alongside architects, structural engineers, and other team members to create detailed project plans and designs.

Perform feasibility assessments and on-site invest...
real estate constructionleadershipcivil engineeringexecutionproject engineeringconstruction projectscivil project management

Sales Manager Pune
ICICI HOME FINANCE COMPANY LTD 1.00 to 6.00 Years Pune 12 Nov, 2024

Job Title: Sales Manager (Home Loans & Mortgage Products)

As a Sales Manager for home loans and other mortgage products, you...
field salessales

Import And Export Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Regulatory Compliance: Ensure compliance with all relevant international trade regulations, customs requirements, and documentation standards.

Logistic...
import sourcingimport logisticsexport importexport documentation

Accounts Executive
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Manage accounts payable and receivable processes, ensuring timely and accurate payments and collections.

Process and verify invoices, e...
balance sheetsales taxaccountstaxationfinancegstaudittallyauditing

Production Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Roles and Responsibilities :

Plan, organize, and control daily production activities to meet customer requirements and company goals.

Ensure efficient use of...
factory managementfactory operationsproduction planning controlfmcg operations

Hr Service Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 1.00 to 5.00 Years Pune,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Delhi 12 Nov, 2024

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

PREV
NEXT

understanding of relevant laws Job Openings

Responsibilities Build a rapport with potential customers to improve the possibility of a sale in the future Maintain a customer database and communicate with them <... storesbusiness developmentretail salesinsurancechannel salescustomer servicecounter sales

Responsibilities Conceive and develop efficient and intuitive marketing strategies Organize and oversee advertising/communication campaigns (social media, TV etc.), ... advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Job Title: Sales Manager (Home Loans & Mortgage Products)

Job description Good organizational and prioritisation skills Analytical and problem-solving skills Multi-cultural awareness Passion for customer servi... process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Build a rapport with potential customers to improve the possibility of a sale in the future

Maintain a customer database and communicate with them
<...
storesbusiness developmentretail salesinsurancechannel salescustomer servicecounter sales

Responsibilities

Conceive and develop efficient and intuitive marketing strategies

Organize and oversee advertising/communication campaigns (social media, TV etc.), ...
advertisingbrandingsfdcarbitrationresearchvisualforcetriggerstrackingbusiness development

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors