understanding risk jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

understanding risk Job Openings

Showing 29751 - 29800 of 46325 Jobs

Child Life Specialist

NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

PLM Team Center Developer

Orcapod Consulting Services Pvt Ltd 3.00 to 8.00 Years Delhi,Noida 29 Oct, 2024

plm

plm enovia

Network Engineer

ARYAN TECHNOLOGY 0.00 to 4.00 Years Delhi,Bangalore, Chennai, Pune, Mumbai City 29 Oct, 2024

Demand Generation Manager

SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Port Blair 29 Oct, 2024

Quality Control Manager

OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Delhi,Bangalore, Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Vasco Da Gama, Khagaria 29 Oct, 2024

Liaison Executive

Hunarmand India Private Limited 1.00 to 5.00 Years Delhi,Noida 29 Oct, 2024

Promoting projects:Promoting ideas and projects

government operations

government liasioning

Urgent hiring for Content Writer

Stemford India Pvt Ltd 1.00 to 6.00 Years Delhi 29 Oct, 2024

Position: Content Writer

Jo...
content writingcontentcontent editingsearch engine optimization

Data Engineer (Lead) - Wipro) PAN India
Wroots Global Private Limited 6.00 to 9.00 Years Delhi,Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City 29 Oct, 2024

Immediate Joiners or 15 days Notice period is Preferred. Skills: DBT, GCP, Big Query along with rest technologies. Responsibilities
dbttoolssqldata warehousingsnowflakebuildhadoopbig datadataquery

Network Support Engineer
Tech Mahindra Ltd 1.00 to 3.00 Years Noida 29 Oct, 2024

Looking for Networking Engineer L1 Voice Support. Qualification - Graduate with Computer Science Background is mandatory. Engineering background, certification on networking concepts preferred. ...
networkingtroubleshootingnetwork engineering

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Technical Account Manager
TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Panchkula,Bangladesh, Panipat, Bangalore, Hisar, Chennai, Kurukshetra, Malaysia, Gurugram, Yamunanag 29 Oct, 2024

Responsible for customer satisfaction, retention and reference-ability for all assigned account.

Establish and maintain a technical rela...
technical supportoperationsbioprocess engineeringanalyticalprocess

Electrical & instrumentation technician
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Mohali,Buxar, Kishanganj, Vijayawada, Sheohar, Karbi Anglong, Golaghat, Amalapuram, Other Bihar, Por 29 Oct, 2024

Electrical & instrumentation technician provides mill-wide electrical engineering support for AC/DC electrical equipment including power generation, electrical distribution, drives, breakers, tra...
planningcontrolautomationanalysisengineeringinstrumentationprocessriskinspectionmechanicalsystemshthatechnicianelectricalfactor

Hiring For Customer Service Manager
Latisha Interprises 0.00 to 3.00 Years Chandigarh,Jaipur, Dehradun, Indore, Raipur, United Arab Emirates, Kota, Navi Mumbai, Sangli, Thane, 29 Oct, 2024

Our company is searching for a motivated and experienced customer service manager to lead our customer service department. Your goal will be to provide outstanding customer service to our clients...
managementexceloperationsword

Sr Business Manager Insurance
Niyukti Management Consultants Hiring For Insurance 6.00 to 11.00 Years Chandigarh,Varanasi, Jaipur, Noida, Ghaziabad, Kanpur, Lucknow, Gurugram, Faridabad, Delhi 29 Oct, 2024

Urgent | Apply JOB For Sr Business Manager Elite Vertical Top 5 Insurance salary up to 6 Lac Insurance, Location DelhiGurugramNoidaChandigarhFaridabadG...
salesinsurance salesinsurance agency managementsales managersr agency managerbusiness manager

Production Engineer
Prime Placement Vision Hiring For Prime Placement Vision Private Limited 0.00 to 4.00 Years Chandigarh,Surat, Qatar, Guwahati, Ahmedabad, Gandhidham, United Arab Emirates, Rajkot, Hyderabad, J 29 Oct, 2024

The Production Engineer is responsible for planning, coordinating, and overseeing the manufacturing process to ensure products are produced efficiently, on time, and within budget. This role invo...
productionproduction engineeringproduction planningproduction management

Hiring For Quality Inspector
Latisha Interprises 0.00 to 4.00 Years Chennai,Vellore, Ooty, Coimbatore, Bangalore, Kochi, Hyderabad, Vijayawada, Other Kerala, Mangalore 29 Oct, 2024

We are currently searching for an experienced and highly analytical quality inspector to join our production department. As the quality inspector, you will uphold the safety regulations of our co...
productiondesign engineeringmaintenancemanufacturing

Billing Operations Analyst - Carrier Disputes
Cynosure Corporate Solutions 4.00 to 9.00 Years Chennai 29 Oct, 2024

Skills & Experience:

Experience within a European mobile operator or MVNO would be advantageous.

Understanding national codes, number ranges, IMSI, and how t...
billinggenerationratingictcdrcsgi

Junior Sales Executive
Futurehook Technologies Pvt Ltd 1.00 to 3.00 Years Chennai,Bangalore, Hyderabad 29 Oct, 2024

We are seeking a dynamic Junior Product Consultant to join our field sales team in Bengaluru. This role is ideal for a self-motivated individual with a strong understanding of smart hom...
kannadatravel salesfield salesnegotiationsales

Sales Manager E-Surveillance business - PAN India
Smart Source 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Sales Manager E-Surveillance business Job Location - PAN India

This is an individual contributor role in a high-performance enviro...
enterprise salescontrolsalesaccesssurveillancecctvb2b salesfirealarm

Enterprise Technical Architect-Tools & Operations
UNIMORPH CONSULTING LLP 10.00 to 20.00 Years Chennai 29 Oct, 2024

Please send your Word format resume with CTC and Notice period details at hidden_email Role : Mgr ADE Enterprise Technical Architect-Tools ...
operations managementopen source toolstools oprationorbus infinity

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Chartered Accountant
Sampathi Credits Private Limited 1.00 to 3.00 Years Chennai 29 Oct, 2024

Job Overview We are looking for a motivated and young Chartered Accountant to join our finance team at Sampathi Credits Private Limited. The successful candid...
treasurycompliancefinancial analysisauditingfinancial reportingaccounting

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

Senior Data Scientist
Taggd 7.00 to 9.00 Years Chennai,Bangalore, Pune, Nagpur 29 Oct, 2024

Purpose of the Position: We are seeking a talented and experienced Senior Data Scientist to join our growing team. The ideal candidate will have a strong background in su...
pythonmachine learningartificial intelligencebigdatadata science

Senior Solutions Manager
OMEGA HEALTHCARE MANAGEMENT SERVICES PRIVATE LIMITED 10.00 to 16.00 Years Chennai,Bangalore 29 Oct, 2024

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales

BPM Consultant
CONSULTTRINITY SERVICES PRIVATE LIMITED 3.00 to 8.00 Years Chennai,Hyderabad 29 Oct, 2024

Job Title: Camunda BPM Developer Location:Chennai & Hyderabad Experience: 4 Years Work Mode:Hybrid Job Type: springmicroservicesbpmmodelerboot

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Financial Analyst
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop Financial Models: Build and maintain complex financial models to forecast future financial performance, analyze investment opportunities, and assess potential ri...
advanced excelbank reconciliationoperationstds calculationfinancial reportingtallymis reporting procurementexcel report

Assistant Finance Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Buyer (Commodity)
DOMNIC LEWIS PRIVATE LIMITED 3.00 to 7.00 Years Chennai,Bangalore 29 Oct, 2024

This role involves collaborating with global and regional teams to drive strategic purchasing initiatives and ensure the efficient, sustainable, and innovative management of the supply chain. Thi...
supplier managementcontractspurchaseindirectrenovationcontrolcapexcostconstructioncommodityglobal

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Chennai,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Noida, Hyderabad, Kolkata, Lebanon, Gur 29 Oct, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

Test Automation Architect
UST Global 10.00 to 16.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvanananthapuram 29 Oct, 2024

Test Automation Architect Position Overview: We are seeking an experienced Test Automation Architect to design, develop, and maintain robust automation framewo...
pythonquality assurancejavaseleniumtosca

EBS Apps technical
LTIMindtree Limited 10.00 to 20.00 Years Chennai,Bangalore, Noida, Hyderabad, Pune, Mumbai City, Delhi 29 Oct, 2024

LTIMindtree is hiring for Apps technical job opportunity. Exp required: 5 to 12 yrs Location: All LTI Offices Below is the JD: Oracle Module Expertise Oracle Inventory Order Management and Cu...
apioracle inventoryoracle soa suiteebswebservicesoracle order managementoracle scmr12oracle ebs

Housekeeping Supervisor
NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Housekeeping Supervisor to lead our team of room attendants and ensure we provide excellent customer service. Housekeeping Supervisor responsibilities include organizing emp...
oshacustomer servicefront deskguest satisfactionclean roomssafety hazardscleanlinessroom attendantsguest rooms

Digital Marketing Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

Job Title: Digital Marketing Manager - U.S. based Home Elevator Manufacturing company near Chennai. Job Summary - We are looking for a skilled Digital Marketing Manager to join our team - a l...
seodigital marketingcreative designinginternet researchinternet marketingonline lead generationcreative writingcreative optimization

All India Sales Manager
Pneumatic Vacuum Elevators and Lifts-India Private Limited 3.00 to 8.00 Years Chennai 29 Oct, 2024

All India Sales Manager - Home Elevators Location: near Chennai Job Summary: We are seeking an experienced All India Sales Manager to lead our sales efforts for home elevators across the count...
sales processlead generationbusiness developmentmarketing automation

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

EWM Functional Consultant
LTIMindtree Limited 5.00 to 10.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Mumbai City 29 Oct, 2024

Greetings from LTIMindtree!! We have an urgent requirement for EWM Functional Consultant Experience: 5yrs Hiring Location-Across LTIMindtree

SAP EWM Experience of working with Decen...
saphana

Development Director
NEW ERA LIFE CARE PRIVATE LIMITED 22.00 to 0.00 Years Bangalore,Chennai, Noida, Hyderabad, Kolkata, Gurugram, Pune, Dhubri, Mumbai City, Delhi 29 Oct, 2024

We are looking for a person who is as passionate and enthusiastic about our organizations mission as we are, someone with an understanding of the importance this work has in driving change in com...
marketingroidigitalservicebusinessdevelopmentoversightcustomermanagementgenerationexcellentpatientsleadprojectprofessional

Procurement and Purchase Executive
ARKNINE TECHNOLOGIES PRIVATE LIMITED 3.00 to 8.00 Years Bangalore,Kolkata, Gurugram, Mumbai City, Delhi, Ahmedabad 29 Oct, 2024

Procurement and Purchase from Domestic and International Fabric Manufacturers. Manage Companys Purchase and Sales of Products and Services and convert orders from buyers Negotiate with external v...
fabric sourcingsourcingprocurement

Casa Sales Officer
LIVE CONNECTIONS PLACEMENTS PVT LTD 0.00 to 4.00 Years Bangalore,Vijayawada 29 Oct, 2024

Relationship Manager for CASA (Current Account and Savings Account) sales: Job Opportunity: Relationship Manager - CASA Sales Or Lap and home loan Experience: 1 years We are seeking an experi...
lapcasahome loans

Assistant Manager Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 6.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Revenue Accounting:

Record and monitor revenue transactions to ensure they are recognized in the correct accounting periods.

Prepare and review journal entri...
advanced exceloperationstds calculationtallypreparationtdsvoucherbillingexcel reportprocurementfinancial reporting

Office Assistant
LEADZN PRIVATE LIMITED 6.00 to 11.00 Years Bangalore,Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a competent Office Assistant to help with the organization and running of the daily administrative operations of the company.
What does an office assistant do
The i...
yield managementschedulingoperationsfrontofficesales coordinationfront office managementsalesdevelopmentbusinessmanagersupervisorproposalaccount

Field Operator
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

Field Operator I sets up, operates and troubleshoots a variety of machines and/or equipment on customer site in accordance with established procedures and guidelines. Reads and interprets blu...
marketinglabfielddataentryassistancestoreproductionwelderoperatorcategorymanagerforemanclerkassistant

Regional Marketing Manager
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Zimbabwe, Mozambique, Afghanistan, Chennai, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mum 29 Oct, 2024

We are looking for a goal-oriented regional marketing manager to implement marketing campaigns in accordance with the regions demographics. In this role, your responsibilities will include foreca...
regional marketingmarketingsales administrationlogistics managementdistribution managementsales coordinationregional managementpublictransportation managementcoordinatormanagerrelationsexecutive

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Demand Generation Manager
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 18.00 to 25.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Demand Generation Manager to develop and implement strategies to generate leads and revenue for the company. You will be responsible for working closely with the sales and m...
servicetelemarketinginsurancedigitalgoodappointmentsbusinesscrmdevelopmentcommunicationcustomersalesmarketingoutboundgenerationcallslife

Quality Control Manager
OVERNET TRADING PRIVATE LIMITED 24.00 to 25.00 Years Bangalore,Raipur, Vapi, Hyderabad, Gurugram, Mumbai City, Mahesana, Delhi, Vasco Da Gama, Khagaria 29 Oct, 2024

We are looking for a detail-oriented quality control manager to ensure the manufacturing production lines run smoothly and generate a consistently suitable output of products that meet quality an...
salestechgeneralqualityseniorprocurementcontrolequipmentproduction headsupervisoroperatorelectricalinstrumentmanager

Financial Analyst
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Bangalore,Noida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop Financial Models: Build and maintain complex financial models to forecast future financial performance, analyze investment opportunities, and assess potential ri...
advanced excelbank reconciliationoperationstds calculationfinancial reportingtallymis reporting procurementexcel report

PREV
NEXT

understanding risk Job Openings

What does an office assistant do

Job description Solution Development Skill sets Required. Domain expertise in either of the areas: Real World Data solutionspresales

Job description Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part... payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical

Accountant Responsibilities:

What does an office assistant do

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales

Job description

Developing an understanding of the strategies that drive our growth, you will be at the forefront of how we evolve to meet our goals. We have Finance Business Part...
payrollsupply chainprocurementrisk managementcustomer developmentforecastingfinancial reportinganalytical