well informed jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

well informed Job Openings

Showing 4001 - 4050 of 4199 Jobs

Sales Officer

MSPIRE VENTURES PRIVATE LIMITED 0.00 to 2.00 Years Rajkot 26 Oct, 2023

Key Responsibilities:

Generate leads and build a strong prospect pipeline.
Deliver persuasive sales presentations.
Develop and maintain client rela...
housing loandirect salescasa salesinsurance saleshome loanssalesmortgage loans

Urgent hiring Accountant Assistant Cashier Dubai UAE

Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Nellore 26 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
accountingcashiersdocument controlcashier activitiessaleslogistic regressiondata analysissales processaccount management

Marketing Engineer/Executive

HARK EMPLOYMENT EXPERTS PRIVATE LIMITED 0.00 to 1.00 Years Navi Mumbai 26 Oct, 2023

Urgent hiring Accountant Assistant Cashier Dubai UAE

Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Kurnool 26 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
accountingcashiersdocument controlcashier activitiessaleslogistic regressiondata analysissales processaccount management

Sales Executive Jaipur

EXECUTIVE 81 HR SOLUTIONS PRIVATE LIMITED 1.00 to 2.00 Years Jaipur 26 Oct, 2023

field sales

sales

business development management

direct sales

business development executive

WE are Hiring Computer Operator Data Entry Cashier UAE Dubai

Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Ernakulam 26 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
sales processsalesdocument controlaccount managementdata entrycashiersdata analysisaccountinglogistic regression

Managed Services Employee Vetting & Background checks Executive

KPMG 1.00 to 5.00 Years Noida 26 Oct, 2023

verbal communication skills

written communication skills

problemsolving skills

attention to detail

Marketing Manager

Vaishnavi Services 16.00 to 25.00 Years Datia 26 Oct, 2023

advertising research

integrated marketing

market intelligence

marketing accountability

Lead Software Engineer - Java Lead

JPMorgan 2.00 to 9.00 Years Chennai 26 Oct, 2023

Job Summ...
jqueryjavamvcsql servercustomer relationsroot cause analysissoftware development methodologiesroot causespring bootunit testingliquidity riskproblem solvingcomputer science

UX/Visual Designer
IBM India Pvt Limited 0.00 to 4.00 Years Ahmedabad 26 Oct, 2023

Introduction Thomas J. Watson said it best: Good design is good business. Visualization is critical to discovering data-driven insights and effectively communicating that knowledge to others. Desi...
visual designweb site productioncustomer relationsdesignadvertisingadobe creative cloudtask analysisuser scenariosdesign thinkingdesign researchcreative designusability testingproduct managementinteraction designiotleancloud

Specialist, Information Security
Fiserv India Pvt Ltd 8.00 to 10.00 Years Chennai 24 Oct, 2023

Calling all innovators find your future at Fiserv. We re Fiserv, a global leader in Fintech and payments, and we move money and information in a way that moves the world. We connect fina...
certified information security managerweb application firewallpostingfortune 500social mediadata securitycyber securitykey managementdigital assetsproblem solvingweb applicationcomputer scienceaccess managementsecurity servicesbehavioral tra

Sales Manager
MSPIRE VENTURES PRIVATE LIMITED 1.00 to 5.00 Years Pune 23 Oct, 2023

Job Title: Sales Manager (NBFC) Product - LAP (DSA Vertical) / BL(Unsecured) Job Overview: We are seeking a highly motivated and results-driven Sales Manager to lead our sales team in a Non-Ba...
team managementlead generationtarget achievementfield workcommunication skills

Vacancy for Sales Executive Front Office Receptionist in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Pune 23 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
account managementdata entrydocument controlsales processsaleslogistic regressiondata analysiscashier activitiescashiers

Office Manager
ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City 23 Oct, 2023

Office Manager Job Responsibilities:

Supports company operations by maintaining office systems and supervising staff.

Maintains office services by organizing...
managementmicrosoft officeaccountscustomer relations

Product intern - Testing
UFABER EDUTECH PRIVATE LIMITED 0.00 to 2.00 Years Navi Mumbai 23 Oct, 2023

Following are the responsibilities for the same. 1. Manage CMS to ensure a seamless and organized workflow for publishing and updating product content. 2.Collaborate with the Pr...
website testingcontent managementtestingproduct management

Merchandiser
ARYAN TECHNOLOGY 0.00 to 4.00 Years Pune 20 Oct, 2023

Merchandiser Responsibilities:

Planning and developing merchandising strategies.

Analyzing sales figures, market trends and customer behavior to determine product needs.
...
merchandise planningsales administrationsales coordinationmerchandisingdriving resultsvisual merchandisingassociate developmentretail sales

We are hiring Accountant Finance Cashier Data Entry Dubai UAE
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Pune 20 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
accountinglogistic regressiondocument controldata entrysales processcashiersdata analysisaccount managementcashier activities

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Pune 20 Oct, 2023

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

Warehouse Supervisor Accountants in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mangalore 20 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
cashiersaccount managementsales processaccountingsalesdata analysiscashier activitiesdocument controllogistic regression

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Hyderabad 20 Oct, 2023

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

Accounts & Administration Executive
ARYAN TECHNOLOGY 0.00 to 4.00 Years Gurugram 20 Oct, 2023

Accountant Responsibilities:

Complying with all company, local, state, and federal accounting and financial regulations.

C...
tallyaccountingauditing

Social Media Analyst
NetSysCon Consulting LLP Hiring For Global Communications Firm 5.00 to 10.00 Years Gurugram 20 Oct, 2023

We are looking for a Sr Analyst Digital Advisory for a global communications firm. Job Profile: We are looking for an ambitious, proactive, and motivated indi...
advisorydata analyticssocial media communicationssocial media optimizationdigital marketingdata analysisdashboardssocial mediasocial media advertising

Marketing Intern
Gupta & Gupta Pvt Ltd 0.00 to 1.00 Years Delhi 18 Oct, 2023

JOB DESCRIPTION Marketing & Brand Intern. As a Marketing & Research Intern, you will be responsible for assisting the marketing and research teams in conducting market research, analysing data, ...
marketingbrand management

Product Development Manager
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Mumbai City 18 Oct, 2023

Key Responsibilities: Market Research: Conduct thorough market research to identify emerging trends, consumer preferences, and competitive landscapes within th...
Design CollaborationMarket Insight

Assistant Manager NE Sales for a Leading Product Based Company with Products
DOMNIC LEWIS PRIVATE LIMITED 8.00 to 11.00 Years Delhi 18 Oct, 2023

Assistant Manager NE Sales for a Leading Product Based Company with Products like Elevator Systems

Managing the entire sales cycle, from inquiry generation to order f...
sales planningcontract managementfollow-up sales activitysales

Senior Technician, Technical Support (I4)
Dell 0.00 to 4.00 Years Bangalore 18 Oct, 2023

Senior Technical Support Technician Join us to do the best work of your career and make a profound social impact as a Senior Technical Support Technician on our Technical Supp...
troubleshootingmechanicalinspectionairpreventive maintenanceeuropean works councilsequal employment opportunityoffice 365social impactdrive resultsbonus programsproblem solvingmedical historymachine learningtechnical supportoperating system

Portfolio Manager
Vaishnavi Services 16.00 to 25.00 Years Vadodara 16 Oct, 2023

Portfolio Manager is a financial professional who is responsible for managing investment portfolios on behalf of individuals or organizations. Portfolio Managers analyze market trends, evaluate i...
registered investment advisorcompliance officersinvestment advisor compliancecertified investment management analystcertified financial plannerportfolio managementportfolio marketingportfolio managersseparately managed accounts

Executive Assistant
Vibgyor Enterprises Hiring For Personal assistant 3.00 to 8.00 Years Noida 16 Oct, 2023

Dear Candidate, Urgent opening forPersonal or Executive Assistant, for our end client (working into Financial and Agriculture domain- Mnc company) Working Location: Gur...
travel managementcalendar managementexecutive assistantpersonal secretarymeetings booking

Purchase Executive
TALENTCO HR SERVICES LLP 4.00 to 7.00 Years Thane 16 Oct, 2023

Position Overview:

The Retail Fruits and Vegetables Operations cum Buying Executive is responsible for overseeing the efficient and effective operations of fruits and...
operations managementpurchase managementpricing strategypromotional

Assistant Manager MIS
NEW TALENT SEED CONSULTANTS 4.00 to 8.00 Years Thane 16 Oct, 2023

Dear Candidate, We are looking for an Assistant Manager - MIS/Reports for a reputed organization in Mumbai. Requirements: Minimum Graduate Experience: 4 to 5 years of relevate experience Lo...
analytical skillsoperation monitoringcustomer relationship

Urgent hiring in Accountant
M/S ALL INDIA MARKETING AND HR SOLUTION Hiring For M/S ALL INDIA MARKETING AND HR SOLUTION 2.00 to 3.00 Years Noida 16 Oct, 2023

Accountant Job Description We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can ex...
taxaccount managementexpensesfixed assetsincome taxaccountancybalanceaccounting

We are hiring Accountant Finance Cashier Data Entry Dubai UAE
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Chennai 16 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
accountinglogistic regressiondocument controldata entrysales processcashiersdata analysisaccount managementcashier activities

Civil Project Manager
AVHAD ENTERPRISES 11.00 to 21.00 Years Chennai 16 Oct, 2023

We are looking for a project manager to be responsible for handling our companys ongoing projects. You will be working closely with your team members to ensure that all project requirements, dead...
gasproject performanceproject coordinationgas analysisdesignengineeringproject closeoutproject initiationgas detectionconstructionoil analysisciviloilmanager

Merchandiser
ARYAN TECHNOLOGY 0.00 to 4.00 Years Bangalore 16 Oct, 2023

Merchandiser Responsibilities:

Planning and developing merchandising strategies.

Analyzing sales figures, market trends and customer behavior to determine product needs.
...
merchandise planningsales administrationsales coordinationmerchandisingdriving resultsvisual merchandisingassociate developmentretail sales

Relationship Manager - Bancassurance Channel - Life Insurance
MITRAM MANPOWER SOLUTION PRIVATE LIMITED 1.00 to 6.00 Years Rayagada 12 Oct, 2023

Job description

This role combines banking and insurance expertise to offer insurance products and services to bank customers

Insurance Officers working in Bancassurance...
agency salesbancafinancial serviceslife insurancebanking salesloan salescasa salesmutual funds sales

Opening for senior accountant dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Rajahmundry 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
document controlaccountingdata entrysalescashierslogistic regressionsales process

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Nagpur 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

Merchandiser
ARYAN TECHNOLOGY 0.00 to 4.00 Years Noida 12 Oct, 2023

Merchandiser Responsibilities:

Planning and developing merchandising strategies.

Analyzing sales figures, market trends and customer behavior to determine product needs.
...
merchandise planningsales administrationsales coordinationmerchandisingdriving resultsvisual merchandisingassociate developmentretail sales

Equity Dealer - Broking
AICS Consultancy Service Pvt Ltd 2.00 to 7.00 Years Noida 12 Oct, 2023

Position : Equity Dealer -- Broking Location : Noida ,Roorkee ,Ghaziabad(near Vaishali metro),Bathinda ,Jammu, Patiala, Bikaner, Jodhpur, Ambala, Karnal, Lucknow Annual CTC : Up to 6 lac(hike w...
nismcross sellingequity tradingmutual fundsbrokingthird party productsinvestment advisorytraderssales executive

Portfolio Manager
Vaishnavi Services 16.00 to 25.00 Years Mysore 12 Oct, 2023

Portfolio Manager is a financial professional who is responsible for managing investment portfolios on behalf of individuals or organizations. Portfolio Managers analyze market trends, evaluate i...
registered investment advisorcompliance officersinvestment advisor compliancecertified investment management analystcertified financial plannerportfolio managementportfolio marketingportfolio managersseparately managed accounts

Immediately hire for Data Entry Cashier and Sales in Dubai apply now
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Mysore 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data analysiscashier activitiessalesaccountingdocument controlcashiersaccount managementdata entrylogistic regression

Sales Executive
SURPASSING HR SOLUTION PRIVATE LIMITED 2.00 to 7.00 Years Mangalore 12 Oct, 2023

Urgent Opening for Sales Executive into Automobile Industry. Job Roles & Responsibilities :

Analyze the local auto parts market, identify potential retail customers, and tailor pitche...
salesparts sourcingparts ordering

Stores Assistant Store in-charge in Dubai
Always International Manpower Service Hiring For Accountant Data Entry Cashier Sales Job in Dubai 1.00 to 5.00 Years Kochi 12 Oct, 2023

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Complying with all company,...
data entrydocument controlsalesaccountingsales processlogistic regressioncashier activitiescashiersaccount management

Project Manager (Construction Services)
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi...
flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Operations Executive and marketing executive
Williams Consulting Pvt Ltd 1.00 to 2.00 Years Gurugram 12 Oct, 2023

Operation & MARKETING EXECUTIVE KRAs S. No.Tasks to be done100% Order Management & Customer Handling70% New quotation to be raised and sent to customers (In discussion with directors) Followu...
marketingoperationsmarketing executive

Executive Assistant
Vibgyor Enterprises Hiring For Personal assistant 3.00 to 8.00 Years Delhi 12 Oct, 2023

Dear Candidate, Urgent opening forPersonal or Executive Assistant, for our end client (working into Financial and Agriculture domain- Mnc company) Working Location: Gur...
travel managementcalendar managementexecutive assistantpersonal secretarymeetings booking

Store Keeper
Orbitouch Outsourcing Private Limited 1.00 to 5.00 Years Bangalore 12 Oct, 2023

Urgent || Hiring || Store Keeper|| Bangalore|| Male Profile- Store Keeper Min experience- 1 years Ctc- 3.6 lpa(Depends upon interview) Location- Bangalore Working days and t...
store keepingstorepurchase ordersitematerial managementinventory managementstore operations

Scrum Master
Online PSB Loans Limited 6.00 to 9.00 Years Ahmedabad 12 Oct, 2023

Scrum Master Qualifications A candidate must possess at least a bachelors degree in computer science or related field to be considered for a Scrum Master job role. Working knowledge of Agile m...
agile methodologyscrum agile development methodology

Sales Development Manager
TEKPILLAR 2.00 to 6.00 Years Ahmedabad 12 Oct, 2023

Summary: As a Sales Development Manager, you will oversee a high-performing sales team while increasing client satisfaction and revenue in our flourishing BFSI and insurance divi...
insurancemarketingmanagementsalesbfsileadpaymentfmcg

PREV
NEXT

well informed Job Openings

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Accountant Responsibilities:

Accountant Responsibilities:

Accountant Job Description We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can ex... taxaccount managementexpensesfixed assetsincome taxaccountancybalanceaccounting

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Job description This role combines banking and insurance expertise to offer insurance products and services to bank customers Insurance Officers working in Bancassurance... agency salesbancafinancial serviceslife insurancebanking salesloan salescasa salesmutual funds sales

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Urgent hiring for Accountants Finance ,Data entry Cashier Sales Marketing , Logistic Supplier Chain , Warehouse etc. Accountant Responsibilities:

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi... flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Accountant Job Description We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can ex...
taxaccount managementexpensesfixed assetsincome taxaccountancybalanceaccounting

Job description

This role combines banking and insurance expertise to offer insurance products and services to bank customers

Insurance Officers working in Bancassurance...
agency salesbancafinancial serviceslife insurancebanking salesloan salescasa salesmutual funds sales

Project Manager Job Description Template We are looking for a project manager to be responsible for handling our companys ongoing projects. You wi...
flexibleindustryriskcommunication.micromanagementnegotiation.organization.financialplanning.knowledge.avoidance.