Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Tool Designer / Design No of Vacancies: 2 Qualification: DTE or DME Specialisation: Tool Design - Press Tool (Compressive Stage Tool) Experience: 3 Yrs Above Gender: Male Age group: 25 TO 40 Des...
autocad design graphicdesign automation fixtures 3ddesign tooldesign 3d dte drafting commercial 3DProduction 2Dto3DConversion 3DPrototyping 2DSoftware 3DModelingSoftware 3DScanning DDesign ExterioAs a 3D modeler you will be responsible for creating virtual worlds and characters. You will be breathing life into sketches and concept art. You will be working in a team with lots of other talented ...
3dsmax 3ddesign 3dmodeler 3dmodeling conceptart modelingtools commercialmodels designguidelines namingconventions technologysolutions projectadministration unity3d characterdesign irtualw lds4 Sales Engineer What you will do Support marketing activities by attending exhibitions and conferences Search for potential clients Follow - up with clients and develop long - term relationships Pers...
email marketing sales negotiation search 3d design finish rintbrokering customerrelations 3ddesign 3dprinting businessdevelopment technicalsupport salesengineering technicalassistanceDigital Designer What you will do Research who will use the product and the ways in which it might be used Sketch out ideas to develop concepts Use computer software to develop 3D models of different...
perspectives printers business design writers 3d marketing software research it analysts css3 rintbrokering adobedreamweaver 3ddesign html5 3dprinting productsafety adobeillustrator adobephotoshopGood knowledge in Photoshop, illustrator, Max or Maya 2D- 3D Design Knowledge in HTML- HTML5, CSS- CSS3, Responsive Design, Mobile Apps, Games Design, Character, Logo, Banner Design, Experience in mob...
webapplicationdevelopment 3ddesign webapplication applicationdevelopment 3d max maya logo html5 games design jquery mobile bootstrap photoshop character javascript css3 DesktopApplicationDevelopment llustratWorking as a Business Development Associate with Blues N Coppers Exhibitions you will be responsible to drive forward the custom stall design and build business in the domestic and international marke...
statementsofwork 3ddesign insidesales coldcalling followingup leadgeneration monthlyreports customerservice businessdevelopment communicationskills writtencommunication tatementsofworksowFILE SYSTEM DESIGN ENGINEER Experience : 7 Years Salary : Best in Industry Working Location : Bangalore Bonus : Available Job responsibilities: Responsible for designing and developing the fil...
api mechanical 3ddesign consulting estimation filesystem teamspirit systemdesign systemsoftware computerscience nas bonus design salary science cluster software metadata ageJob Qualifications:-
Job Qualifications:-
Minimum 5 years of piping design & layout experience preferably in Oil & Gas projects in Engineering Consultancy environment. Description: Responsible for piping design & layout, supporting in 3D PDMS...
piping pdms autocad pipe modeling msofficesuite projectengineeringmanagement msoffice 3ddesign plantdesign pipingdesign stressanalysis problemsolving designdrawings analyticalskills designengineering verbalcommunication engineeringconsultGood knowledge in Photoshop, illustrator, Max or Maya 2D- 3D Design Knowledge in HTML- HTML5, CSS- CSS3, Responsive Design, Mobile Apps, Games Design, Character, Logo, Banner Design, Experience in mob...
webapplicationdevelopment 3ddesign webapplication applicationdevelopment 3d max maya logo html5 games design jquery mobile bootstrap photoshop character javascript css3 DesktopApplicationDevelopment llustratDesignation: 3D Designer / Lenticular Designer Experience: Minimum 2 years of experience in 3D design with the knowledge of latest 3D design and software. Qualification- Minimum Graduate Location- ...
patternmaking 3ddesign 3dstudiomax designcad mentalray uvmapping lenticularprinting shading hardsurfacemodeling enticularsoftware lenticulardesign
Qualifications
Minimum Qualifications:
As a 3D modeler you will be responsible for creating virtual worlds and characters. You will be breathing life into sketches and concept art. You will be working in a team with lots of other talented ...
3dsmax 3ddesign 3dmodeler 3dmodeling conceptart modelingtools commercialmodels designguidelines namingconventions technologysolutions projectadministration unity3d characterdesign irtualw ldsPreparation of flow sheets, GA drawings & plant layout for cement plant departments in adherence to guidelines and submit for review. Assists senior colleagues in various tasks in connection with la...
autocad 3ddesign plantlayout writtencommunication 3d cad cement design plants resume proposals equipment adherence completion engineering preparation communication visualization tatementsofw ksow solidw ksJob Qualifications:-
Dear Candidate, Greetings of the day! We are Hiring for, Sr. Offshore Structure Designer Role Introduction: As the Sr. Structural Designer, you work closely with engineers and other designers to a...
foundationdesign projectdesign pilefoundation designengineering structuraldesign engineeringcoordination 2ddrafting infraprojects 3ddesign steelstructures structuraldesign pilefoundations dms/sp3dShould be proficient in 3D design and rendering tools like 3DS Max, Sketch-up, Vray, etc. Tech-savvy who needs to be updated with the latest developments in 3D design, modeling tools and technologies...
3dsmax 3ddesign modelingtools commercialmodels 3d max vray draw design autocad sketchup photoshop rendering developments communication visualization 3DProduction 2Dto3DConversion 3DPrototyping DDesignGood knowledge in Photoshop, illustrator, Max or Maya 2D- 3D Design Knowledge in HTML- HTML5, CSS- CSS3, Responsive Design, Mobile Apps, Games Design, Character, Logo, Banner Design, Experience in mob...
webapplicationdevelopment 3ddesign webapplication applicationdevelopment 3d max maya logo html5 games design jquery mobile bootstrap photoshop character javascript css3 DesktopApplicationDevelopment llustratTool Designer / Design No of Vacancies: 2 Qualification: DTE or DME Specialisation: Tool Design - Press Tool (Compressive Stage Tool) Experience: 3 Yrs Above Gender: Male Age group: 25 TO 40 Des...
autocad design graphicdesign automation fixtures 3ddesign tooldesign 3d dte drafting commercial 3DProduction 2Dto3DConversion 3DPrototyping 2DSoftware 3DModelingSoftware 3DScanning DDesign ExterioWe are looking for equally driven, creative, passionate team-mate 3D modeler & visualizer for creating feel-real 3D models & renders. One must be self-directed & motivated, who, understands sketches...
3dsmax 3ddesign coreldraw 3dmodeler autocad3d 3dmodeling contentwriting commercialmodels caddrawings 3d cad max vray draw corel props color design salary rganizationalwritingskillsDigital Designer What you will do Research who will use the product and the ways in which it might be used Sketch out ideas to develop concepts Use computer software to develop 3D models of different...
perspectives printers business design writers 3d marketing software research it analysts css3 rintbrokering adobedreamweaver 3ddesign html5 3dprinting productsafety adobeillustrator adobephotoshop4 Sales Engineer What you will do Support marketing activities by attending exhibitions and conferences Search for potential clients Follow - up with clients and develop long - term relationships Pers...
email marketing sales negotiation search 3d design finish rintbrokering customerrelations 3ddesign 3dprinting businessdevelopment technicalsupport salesengineering technicalassistanceob Description Diversity hiring only BE/ Masters in Mechanical or related engineering domain. 12 years of working experience in the area of software development, CAD automation, CAD API programming, ...
cad api agile design software mechanical automation engineering presentation communication empower 3ddesign fundamentals kingexperienceShould be proficient in 3D design and rendering tools like 3DS Max, Sketch-up, Vray, etc. Tech-savvy who needs to be updated with the latest developments in 3D design, modeling tools and technologies...
3dsmax 3ddesign modelingtools commercialmodels 3d max vray draw design autocad sketchup photoshop rendering developments communication visualization 3DProduction 2Dto3DConversion 3DPrototyping DDesignAs a 3D modeler you will be responsible for creating virtual worlds and characters. You will be breathing life into sketches and concept art. You will be working in a team with lots of other talented ...
3dsmax 3ddesign 3dmodeler 3dmodeling conceptart modelingtools commercialmodels designguidelines namingconventions technologysolutions projectadministration unity3d characterdesign irtualw ldsB.E / B.Tech ( Mechanical Engineering) with Minimum 5-6 years in Material Handling Equipments, expert in technical drawings and 3D design work using SolidWorks and expert in documentation which meets ...
java javascript linux css html materialhandlingequipments 3ddesign solidworks materialhandling qualitystandards mechanicalengineering 3d design mechanical engineering documentation solidworks 3DProduction 2Dto3DConversion DDesignCompany : LIMITED ROBOTICS COMPANY Post : FACULTY Qualification : B.Tech / Dip in Computer Science / Electronics / Electrical or any Science Hons. Graduate with PCM Location- Kolkata Exp - Fresher or ...
training robotics science electronics omputerscience 3ddesignGood knowledge in Photoshop, illustrator, Max or Maya 2D- 3D Design Knowledge in HTML- HTML5, CSS- CSS3, Responsive Design, Mobile Apps, Games Design, Character, Logo, Banner Design, Experience in mob...
webapplicationdevelopment 3ddesign webapplication applicationdevelopment 3d max maya logo html5 games design jquery mobile bootstrap photoshop character javascript css3 DesktopApplicationDevelopment llustratExpert level knowledge of 3D design and animation in Autodesk Maya, with a strong background in 3D modelling, lighting, UV wrapping, rendering and who demonstrates photo-realistic asset creation. havi...
3ddesign autodeskmaya 3dmodelling unity3d 3d ar uv maya design lighting autodesk wrapping animation rendering 3DProduction 2Dto3DConversion 3DPrototyping 2DSoftware 3DModelingSoftware DDesignHere is the opportunity for individuals, we are seeking CAD Designer for a manufacturing company in Jaipur, Rajasthan Job Requirement: - CAD Designer Qualification ...
autocad cad graphicdesign drawing drafting continuousimprovementfacilitation 3ddesign teammanagement automotivelocksmithing 3d wood design resume windows contracts proposals management omputeraideddesign consultResponsibilities: Any Graduate with 1-2 years experience with design softwares like Adobe Photoshop, Adobe Illustrator, Corel Draw, 2D/ 3D design software/ Flash Should have a creative bent of mind ...
draw corel photoshop illustrator adobe brand 3d brochures design cv advertising dprototyping coreldraw adobeillustrator 2dsoftware 2ddesign 3dproduction adobephotoshop 2dto3dconversion 3ddesignPreparation of flow sheets, GA drawings & plant layout for cement plant departments in adherence to guidelines and submit for review. Assists senior colleagues in various tasks in connection with la...
autocad 3ddesign plantlayout writtencommunication 3d cad cement design plants resume proposals equipment adherence completion engineering preparation communication visualization tatementsofw ksow solidw ksTool Designer / Design No of Vacancies: 2 Qualification: DTE or DME Specialisation: Tool Design - Press Tool (Compressive Stage Tool) Experience: 3 Yrs Above Gender: Male Age group: 25 TO 40 Des...
autocad design graphicdesign automation fixtures 3ddesign tooldesign 3d dte drafting commercial 3DProduction 2Dto3DConversion 3DPrototyping 2DSoftware 3DModelingSoftware 3DScanning DDesign ExterioGraphic/ Product Designer Mango People Graphic/ Product Designer Were looking for Graphic and Product Designers tocreate visual concepts, by hand or using computer software, to communicate ideas that ...
autocad design networking 3d roductdesign 3ddesign adobecreativesuite socialmedia adobephotoshop graphicdesigning timemanagement visualconcepts fineart designbriefs managementskills graphicdesignWe are looking for equally driven, creative, passionate team- mate 3D modeler & visualizer for creating feel- real 3D models & renders. One must be self- directed & motivated, who, understands sket...
3dsmax 3ddesign 3dmodeler 3dmodeling commercialmodels caddrawings 3d cad max vray draw props design autocad modeler lighting photoshop ldraw el colAs a 3D modeler you will be responsible for creating virtual worlds and characters. You will be breathing life into sketches and concept art. You will be working in a team with lots of other talented ...
3dsmax 3ddesign 3dmodeler 3dmodeling conceptart modelingtools commercialmodels designguidelines namingconventions technologysolutions projectadministration unity3d characterdesign irtualw ldsGood knowledge in Photoshop, illustrator, Max or Maya 2D- 3D Design Knowledge in HTML- HTML5, CSS- CSS3, Responsive Design, Mobile Apps, Games Design, Character, Logo, Banner Design, Experience in mob...
webapplicationdevelopment 3ddesign webapplication applicationdevelopment 3d max maya logo html5 games design jquery mobile bootstrap photoshop character javascript css3 DesktopApplicationDevelopment llustratJob Qualifications:-
Job Qualifications:-
We need Piping Draughtsman immediately. Position : Piping Draughtsman Qualification : Diploma / ITI / Vocational Course Experience : 3- 5 yrs Job Location : Andheri, Mumbai Job Duration : 5 mont...
pipingautocaddraftingdrawinglayoutdesigncustomerserviceassetmanagementmanagementcustomerrelationshipdesignrojectengineeringmanagement3ddesignfireprotectionvendtelephonysuppsp3dsalaryNeed Graphic Designer + 3DS Max Designer at Signage Co. at Karol Bagh, Delhi The Company deals in Glow Sign and Signages and other Print Media Stuff Coreldraw Photoshop and 3DS Max software Must Lo...
designprintdealsphotoshopcoreldrawemaildscanning3dsmax2dsoftware3dmodelingsoftware2-ddesign3dproduction3ddesign3dprototypingSkills
We are looking for equally driven, creative, passionate team- mate 3D modeler & visualizer for creating feel- real 3D models & renders. One must be self- directed & motivated, who, understands sket...
3dsmax3ddesign3dmodeler3dmodelingcommercialmodelscaddrawingscadmaxvraydrawpropsdesignautocadmodelerlightingphotoshopldrawcolJob Summary: The AutoCAD/ Civil 3D designer is expected to work on AutoCAD 2D/ Civil 3D drawings, preparing and updating 2D plans and sections Water/ Wastewater/ Sludge Process Units under the superv...
civil3d3ddesignsitelayoutcivilengineeringcommunicationskillsbimcdmdrawpipecivilfactsdesignautocaddrawingdrainageengineeringsupervisionlcommunicationob Description Diversity hiring only BE/ Masters in Mechanical or related engineering domain. 12 years of working experience in the area of software development, CAD automation, CAD API programming, ...
cadapiagiledesignsoftwaremechanicalautomationengineeringpresentationcommunicationempower3ddesignfundamentalskingexperienceJob holder will be responsible for 2d and 3d design of mechanical part and packaging , development of product and manufacturing tool Create 2d and 3d design of product and packaging using pro enginee...
autocadtooldesignmechanicalengineeringcaddesignontinuousimprovementfacilitation3ddesigndesigndevelopmentkingexperiencedigitalconversiondevelopmentdesignpackagingdevelopmentcreotestsWe need Piping Draughtsman immediately. Position : Piping Draughtsman Qualification : Diploma / ITI / Vocational Course Experience : 3- 5 yrs Job Location : Andheri, Mumbai Job Duration : 5 mont...
pipingautocaddraftingdrawinglayoutdesigncustomerserviceassetmanagementmanagementcustomerrelationshipdesignrojectengineeringmanagement3ddesignfireprotectionvendtelephonysuppsp3dsalary© 2019 Hireejobs All Rights Reserved