accident investigation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

accident investigation Job Openings

Showing 51 - 100 of 3808 Jobs

Senior Regulatory Operations Analyst (India)

Leading 1.00 to 10.00 Years All India 17 Aug, 2026

Remote Senior Operations Analyst DataDriven Insights and Resource Planning

remote next 1.00 to 10.00 Years All India 17 Aug, 2026

Predictive Modeling

Forecasting

Performance Reporting

Extraction

Statistical Analysis

Model Development

Resource Utilization Analysis

Industry Trend Analysis

Data Sourcing

Global Marketing Data and Insights Specialist

DNV 1.00 to 10.00 Years Mumbai City 17 Aug, 2026

Medical Officer Claims Processor

Square Business Services Pvt Ltd 1.00 to 10.00 Years Raipur 17 Aug, 2026

Location:

Experience:

Employment Type:

pharmacology

terminology

Data Analyst ( Data Science ) Chennai, Tamil Nadu, India

Arcadia Power, Inc 1.00 to 10.00 Years Chennai 17 Aug, 2026

Exploratory Data Analysis

Remote Customer Service Representative Florida FullTime Remote Role

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

Escalation Management

InboundOutbound Communication

MultiChannel Support

UpsellingCrossSelling

Detailed Documentation

Product Knowledge Mastery

Quality AssuranceKPI Achievement

Trend Reporting

System Issue Reporting

**Experienced Part-Time Remote Outbound Customer Service Representative

vmysmartpros 1.00 to 10.00 Years All India 17 Aug, 2026

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Noida, Nepal, Hyderab 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Nepal, Hyderaba 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Chennai, EthiopiaEthiopia, Bangladesh, South Africa, Bangalore, Noida, Nepal, Hyderabad, Kolkata, Un 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Cluster Medical Director Mumbai

Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City 06 Aug, 2026

Retail Trainer

Ramraj Cotton 1.00 to 10.00 Years Hyderabad, MaduraiMadurai, Bangalore, Chennai, Vijayawada, Tiruchirappalli, Vellore, Mangalore, Tiru 06 Aug, 2026

Job Summary:

Retail Trainer

Ramraj Cotton 1.00 to 10.00 Years Hyderabad, MaduraiMadurai, Bangalore, Chennai, Vijayawada, Tiruchirappalli, Vellore, Mangalore, Tiru 06 Aug, 2026

Job Summary:

wanted Accident & Emergency Care Technology Fresher For Medical Coding

ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Madurai, Thirunelveli, Pudukottai, Salem, Tiruchirappalli, Vilupuram, Namak 06 Aug, 2026

Job Summary We are seeking motivated and detail-oriented fresh graduates in Accident & Emergency Care Technology to join our Medical Coding team. The selected candidates will review patient m...
nursingbiotechnologycardiologybiologydentistrymicrobiologyphysiotherapyaccident care

Retail Trainer

Ramraj Cotton 1.00 to 10.00 Years Chennai, VelloreVellore, Madurai, Tiruchirappalli, Tiruppur, Coimbatore, Bangalore, Vijayawada, Hyde 06 Aug, 2026

Job Summary:

REQUIRED SAFETY SUPERVISOR DABUR INDIA LIMITED

SUMIT KUMAR NEGI 1.00 to 10.00 Years Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Thane, Maharashtra, Bhubaneswar, Bokaro, Jharkhand 03 Aug, 2026

Contact Person :87,96,58,83,40 Rita Mam

Safety Supervisor Dabur India Limited (Job Description)

safetyregulatory complianceemergency responsesafety officer activitiesrisk managementsafety managementsafety trainingcommunicationsafety audit

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Mangalore, HyderabadHyderabad, Chennai, Bangalore, Madurai, Vijayawada, Tiruchirappalli, Vellore, Ti 03 Aug, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Mangalore, HyderabadHyderabad, Chennai, Bangalore, Madurai, Vijayawada, Tiruchirappalli, Vellore, Ti 03 Aug, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Returnship - TM-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a senior claims subject matter expert within a hybrid work model night shift environment applying deep knowledge of HIPAA claims adjudication and both provider and payer ope...
provider relationscustomer experienceuser acceptance testingHIPAA claims adjudicationproviderpayer operationshealth care claims processingHIPAA regulationsprovider reimbursement methodologiespayer domain expertise

Plant Head - Lighting
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Jaipur, DelhiDelhi, Kolkata, Pune, Mumbai City, Haridwar 03 Aug, 2026

Plant Head - Lighting Job Description - Plant Head Role Objective: Handling the plant to achieve plant KPIs by ensuring smooth day to day manufacturing operations, cost contro...
factory operationsmanufacturing operationsproduction planning controlproduction operationsplant operationsproduction head

Sales Manager- Industrial sales
MEGMA SERVICES 1.00 to 10.00 Years Bangalore, Delhi 03 Aug, 2026

Leading European Manufacturing company requires Sales Manager( Industrial sales)-- Bangalore / Delhi One of our client a world s leading European manufacturer of woodworking machinery where all ...
industrial salesmachinary sales

Remote Senior Operations Analyst Data-Driven Insights & Resource Planning
remote next 1.00 to 10.00 Years All India 01 Aug, 2026

Join arenaflex Where Data Meets Innovation in the Travel Industry Are you reputed company to be part of a dynamic team thats transforming how a global leader serves millions of customers arenafle...
SQLPythonTableauanalytical skillscommunication skillsMS Officedata visualizationstatistical analysisproject management

Auditing Mgr- CS
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 31 Jul, 2026

Leading Financial services company requires Deputy Mgr/Mgr (Auditing and compliance)- - Mulund-Mumbai ( Only company secretary qualified need apply) One of our client a leading Financial servic...
company secretarial functionscompany secretarial workamalgamationcompanies actsebi regulations

Site Supervisor
AI MZ-Tech Consultant 1.00 to 10.00 Years Hyderabad, QatarQatar, Panaji, United Arab Emirates, Malaysia, South Goa, North Goa, Vasco Da Gama 31 Jul, 2026

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi...
sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore

Immediate Wanted Biomedical Engineering Freshers for Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, ThanjavurThanjavur, Thirunelveli, Pudukottai, Salem, Tiruchirappalli, Thiruvarur, Nagapatti 31 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
microbiologybiomedical engineeringnursingneurologybiotechnologybiochemistryanesthesiacardiologyoptometry

Walkin drive for Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 31 Jul, 2026

HCLTech | Walk-In Drive | Fraud Analyst | 1st Aug 26 | Bangalore Date: 1st Aug 26 (Saturday) Timing:<...
fraud analysisfraud investigationfraud managementfraud controlfraud detection

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 28 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Mangalore, HyderabadHyderabad, Chennai, Bangalore, Madurai, Vijayawada, Tiruchirappalli, Vellore, Ti 28 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Vellore, Tiruppur, Bangalore, Vijayawa 28 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Urgent | Health Claim Facilitator | Mumbai
Shree Balaji Employment Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

We Are Hiring Health Claim Facilitator Location: Mumbai Key Responsibilities:

Managed cashless and reimbursement health insurance c...
visitclaim investigationfield work

Assistant Manager - Application Security
knowledge Artisan 1.00 to 10.00 Years Kochi 28 Jul, 2026

Were Hiring : Assistant Manager Application Security, IT Audit & GRC (2 Positions) Location : Kochi, Kerala Work Mode : On-site Employment Type : Full-Time Salary : Not a constraint for ...
Application SecuritySecure SDLCVAPTVulnerability ManagementGRCRisk ManagementSecurity ToolsIT Security AuditsERPApplication Security Reviews

Fraud Analyst AML KYC Banking Operations Chargebacks 1PlusYrs | Hyd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 28 Jul, 2026

Job Description (JD) Fraud Analyst | AML/KYC | Banking Operations Location: Hyderabad Experience: 14 Years CTC: Up to 4 LPA Shift: US Rotational Shift Notice Period: Immediate to 15 Days Pref...
Fraud InvestigationFraud DetectionAMLAnti Money LaunderingKYCFraud AnalystFraud Operations

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Hyderabad, MaduraiMadurai, Bangalore, Chennai, Vijayawada, Tiruchirappalli, Vellore, Mangalore, Tiru 28 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Kochi, KanpurKanpur, Rudrapur, Lucknow, Vijayawada, Delhi 28 Jul, 2026

Urgent Requirement Safety Supervisor Experience - 1yr to 5yr Safety - 20,000 to 45,000 Location - Delhi, Lucknow, Kanpur,Rudrapur, Vijayawada,Kochi root cause analysissafety trainingsafety officer activitiessafety analysissafety auditsemergency planningconfined space rescueaccident preventionsafety data sheets

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Coimbatore, ChennaiChennai, Hyderabad, Bangalore, Madurai, Tiruchirappalli, Vellore, Tiruppur, Vijay 28 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Bodyshop Advisor
NAARA MOTORS LLP 1.00 to 10.00 Years Bangalore 28 Jul, 2026

Body Shop Advisor Company:Naara Kia Motors Location:Bangalore (JP Nagar / Thalaghattapura)Role Overview Naara Kia Motors is ...
repairprepare accurateefficiently resolve customer complaintsinsurance proceduresexplaining repair scopes

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Bangalore, VelloreVellore, Mangalore, Madurai, Chennai, Vijayawada, Hyderabad, Tiruchirappalli, Tiru 28 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
retail trainingojtproduct trainingtraining managementdevelopment coachinginduction trainingskill gap analysisorientation programs

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Vijayawada, GunturGuntur, Nellore, Vishakhapatnam, Bangalore, Chennai, Hyderabad, Pune, Mumbai City, 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Logistics Coordinator
FUTURZ STAFFING SOLUTIONS PRIVATE LIMITED 1.00 to 10.00 Years Vijayawada, BangaloreBangalore, Chennai, Hyderabad 22 Jul, 2026

Executive profile – Chennai, Bangalore, Hyderabad .Vijayawada* Flipkart off-role *Executive and FTC - 25k-30k NTH* *Senior Executive - 4.2 LPA *5 LPA* *Location:* Bangalore (Narsapura) H...
inventory managementsupply chain managementsupply chain operationslogistics coordinationlogistics operationsoperational excellencewarehouse operationslogistics management

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Mangalore, HyderabadHyderabad, Chennai, Bangalore, Madurai, Tiruchirappalli, Vijayawada, Vellore, Co 22 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
training programstraining managementproduct trainingretail trainingorientation programsinduction trainingojtskill gap analysis

Inventory Control Manager
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, MoradabadMoradabad, Ghaziabad, Lucknow, Varanasi, Firozabad, Faizabad, Agra, Hyderabad, Kolk 22 Jul, 2026

An Inventory Control Manager team supervisiondatatechnicalanalysistime managementanalyticalforecastingskills

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Vellore, Tiruppur, Bangalore, Hyderaba 22 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
training programstraining managementproduct trainingretail trainingorientation programsinduction trainingojtskill gap analysis

Retail Trainer
Ramraj Cotton 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Vellore, Tiruppur, Bangalore, Hyderaba 22 Jul, 2026

Job Summary: We are looking for a dynamic Cluster Trainer to drive training and capability development across retail stores. The role focuses on enhancing sales performan...
training programstraining managementproduct trainingretail trainingorientation programsinduction trainingojtskill gap analysis

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

SOC & NOC Analyst
Muthoot Microfin 1.00 to 10.00 Years Kochi 22 Jul, 2026

Role & responsibilities Monitor alerts generated by SOC and NOC tools. Perform first-level analysis and ticket creation. Escalate incidents based on defined procedures. Monitor server, network...
Network Monitoring ToolsBasic NetworkingWindowsLinux FundamentalsSecurity Monitoring ConceptsEndpoint Security ToolsIncident Ticket ManagementBasic Cloud ConceptsCybersecurity FundamentalsSIEM Monitoring

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

PREV
NEXT

accident investigation Job Openings

Job Summary We are seeking motivated and detail-oriented fresh graduates in Accident & Emergency Care Technology to join our Medical Coding team. The selected candidates will review patient m... nursingbiotechnologycardiologybiologydentistrymicrobiologyphysiotherapyaccident care

Safety Supervisor Dabur India Limited (Job Description)

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi... sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore

Contact Person :97,17,22,36,28 Renu Mam

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job Summary We are seeking motivated and detail-oriented fresh graduates in Accident & Emergency Care Technology to join our Medical Coding team. The selected candidates will review patient m...
nursingbiotechnologycardiologybiologydentistrymicrobiologyphysiotherapyaccident care

Site Supervisor We are looking to employ a dedicated and experienced site supervisor to oversee construction projects and supervise the constructi...
sitecatalystsiterrasite supervisionsite managementsitemindersite integrationsite acquisitionsite engineeringsitecore