actuarial science jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

actuarial science Job Openings

Showing 451 - 500 of 15738 Jobs

Content Strategist, Brand Strategist, Brand content marketing manager

Jobs Territory Hiring For Beauty and Wellness company 1.00 to 10.00 Years Noida 28 Jul, 2026

Content Strategist Role @effora (Job D...
creative strategycontent marketingbrand marketingbrand strategistcontent strategist

Staff Developer (Node.js, React, PWA)
Emerson 1.00 to 10.00 Years Mohali 28 Jul, 2026

If you are an Application Developer with strong Node.js backend and React frontend skills, this role offers the opportunity to build and maintain mobile-friendly, Progressive Web Applications (PWA...
PWAMongoDBREST APISDLCNodejsReactExpressjsNestJSRedux

Biomedical Engineer Trainee
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Ramanathapuram, Pudukottai, Nagercoil, Dharmapuri, 28 Jul, 2026

DESCRIPTION
We are looking for a motivated Biomedical Engineer Trainee to join our team in Chennai. In this role, you will gain hands-on experience in the biomedical ...
biomedical engineeringphysiotherapybiotechnologymedical codingpharmacymicrobiologynursingvirologybiopharmaceuticals

Software Support Engineer
Innervex Technologies Private Limited 1.00 to 10.00 Years Madurai 28 Jul, 2026

Job Description Software Support Engineer Job Title: Software Support Engineer Experience: 12 Years Location: Coimbatore Department: Customer Support / Technical Support About the Role Innerve...
SQLERPCRMHRMSRetailAccounting softwareAPIsWindows OSPostman

Medical Coding for Anesthesiologist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, CoimbatoreCoimbatore, Chennai, Ramanathapuram, Vilupuram, Nagapattinam, Sivagangai, Dharmap 28 Jul, 2026

As an Anesthesiologist, you will play a critical role in patient care during surgical procedures. Your primary responsibilities will include the following: - **Administer Anesthesia**: You will ...
anesthesiaoptometrynursingcardiac anaesthesiadentistlife sciencepharmacistphysiotherapistparamedical

Medical Coding
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 28 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
medical codingpharmacyphysiotherapymicrobiologybiotechnologybiomedicalnursingbioinformaticsmedical lab technology

Agricultural Consultant
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Qatar, Saudi Arabia, Kuwait, Bangalore, Philippines, Ongole, Noida, Chennai, 28 Jul, 2026

Agricultural consultants mechanicaladaptabilitytimeoperationstechnologyhealthmanagementproblem-solvingfarmimproveyourphysicalrepairingorganizationalrelationships

Dot Net Developer
JOB CONNECT Hiring For Winjit Technologies 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

Job Description .NET Developer (Banking Domain)
Position: .NET Developer Location: Dadar, Mumbai Experience: 4 - 6 Years application development.net

System Engineer Dynatrace
LTM 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Delhi, Coimbatore 28 Jul, 2026

Job Title: System Engineer Dynatrace (Observability)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noid...
dynatraceharnesssystemawsengineer

SAP Data Consultant
Techmax Technologies 1.00 to 10.00 Years Kochi 28 Jul, 2026

Company DescriptionTechmax Technologies is an automotive analytics partner transforming business ecosystems with data-driven solutions and CX innovations. Since 2020, weve helped organizations tur...
SAP SDSAP MMSAP FICOPower BIBI toolsSAP DataAnalyticsSAP DatasphereSAP S4HANACDS Views

Senior Software Developer - Backend (Python)
The Nielsen Company 1.00 to 10.00 Years Kochi 28 Jul, 2026

At Nielsen, we believe that career growth is a partnership. You ultimately own, fuel and set the journey. By joining our team of nearly 14,000 associates, you will become part of a community that ...
PythonSQLAPIsAWSGCPAzurebackend systemsobjectoriented programmingPython frameworks

Plant Finance head- Gujrat
MEGMA SERVICES 1.00 to 10.00 Years Ahmedabad 28 Jul, 2026

Leading pharmaceutical company requires Plant Finance Head --Ahmedabad (Mehemdabad)-Gujrat) One of our client a global pharmaceutical company established almost 60 years ago operating in over 9 ...
finance controlplant operations

Data Science Internship in Ahmedabad
MAXGEN TECHNOLOGIES PRIVATE LIMITED 1.00 to 10.00 Years Ahmedabad, GandhidhamGandhidham, Gandhinagar, Mehsana, Rajkot, Patan 28 Jul, 2026

Maxgen Technologies Pvt ltd offers live project internships in ahmedabad. Freshers and Students will getdata science internshipwith machine learnin...
machine learninginternshipdeep learning

Tgt Science Teacher
Educare Ventures Private Limited Hiring For CBSE school 1.00 to 10.00 Years Gurugram 28 Jul, 2026

Excellent opportunity as TGT SCIENCE from a well reputed & established CBSE affiliated school located near to South City-II, Gurgaon. Position: TGT SCIENCE - ...
science teachertgt sciencechemistry teacherphysics teacherbiology teacher

Agricultural Specialist
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Delhi, NoidaNoida, Oman, Qatar, Saudi Arabia, Bangalore, Philippines, Chennai, Kurnool, United Arab 28 Jul, 2026

A park ranger safetyemergencypubliccollectionreservationsservicepatrolcustomerinterpretivefeesituationsvisitorprogramsrangersservices

Junior Flutter Developer
HelixBeat 1.00 to 10.00 Years Coimbatore 28 Jul, 2026

Job Description- Experience: 3 Years Location: Remote / Later on will be Hybrid( Hyderabad, Chennai) Employment Type: Full-time About the Role:We are seeking an experienced Flutter Developer . ...
DartRESTful APIsFirebaseGitJIRAFlutterBloCGetXClean Architecture

IBM Netezza Administrator
LTM 1.00 to 10.00 Years Coimbatore, ChennaiChennai, Hyderabad, Bangalore, Kolkata, Gurugram, Pune, Mumbai City, Delhi 28 Jul, 2026

Job Title: IBM Netezza Administrator
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida, Coimbatore <...
dmlnetezzaddldba

Opening for Lifescience & Paramedicals
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Chennai, CuddaloreCuddalore, Ramanathapuram, Pudukottai, Kanyakumari, Dharmapuri, Coimbatore, Erode, 28 Jul, 2026

Key responsibilities: 1. Provide consulting services in the field of life sciences: As a Life Science Consultant, you will be responsible for offering expert advice and guidance in various areas...
paramedic activitiesmedical codingpharmalife sciencesparamedic

Senior Devops Engineer lead
Vishwa karma 1.00 to 10.00 Years Chennai 28 Jul, 2026

Key Responsibilities

kubernetesaws

DevOps Engineer (Kubernetes Terraform)
LTM 1.00 to 10.00 Years Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 28 Jul, 2026

Job Title: DevOps Engineer (Kubernetes Terraform)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida,...
kubernetesdevopsengineerterraform

Sustainment Developer
ARTECH INFOSYSTEMS PRIVATE LIMITED 1.00 to 10.00 Years Bhopal, BangaloreBangalore, Noida, Hyderabad 28 Jul, 2026

JOB TITLE- Sustainment Developer Job Timings- 5 PM IST to 2 AM IST POSITION SUMMARY: The developer isresponsible for providing expert guidance and eff...
restful apisajaxjson

Precision Agriculture Manager
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, HyderabadHyderabad, Gurugram, Pune, Ahmedabad 28 Jul, 2026

We are seeking an accomplished Precision Agriculture Manager to lead the development and implementation of next-generation precision farming initiatives that improve productivity...
farm managementagricultural researchcrop protectionprecision agriculturesoil mappingbiotechnology

Azure Cloud Engineer
3 KUBED CONSULTING INDIA PRIVATE LIMITED 1.00 to 10.00 Years Bangalore 28 Jul, 2026

Azure Cloud Engineer Dear Candidate, Greetings from 3 Kubed Consulting India Pvt Ltd! We are seeking aCloud Engineer with AI/M...
computer visionazure cloud administratorazure openaiterraform pythoncloud engineerazure cloud engineerazure ai foundry

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Vijayawada, GunturGuntur, Nellore, Vishakhapatnam, Bangalore, Chennai, Hyderabad, Pune, Mumbai City, 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

ONLINE CUSTOMER SUPPORT ENGINEER (Vadodara)
Compucare 1.00 to 10.00 Years Vadodara 22 Jul, 2026

Compucare India Pvt. Ltd. Position: Online Customer Support Engineer (SQL Database) Job Location: Vadodara Job Type: Full time Location: Vadodara Responsibilities: - Provide technical assis...
SQLSQL DatabaseMS SQLMS SQL ServerTechnical Support

Medical Coding for Biotechnology engineer,Bsc Biotech,Msc Biotech
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Thanjavur, Tamil Nadu, Vellore, Sivakasi, Theni, Namakkal, Coim 22 Jul, 2026

Ct Us: HR Shanmuga priya hidden_mobile
DESCRIPTION
Medical Coding is the fastest-grow...
nursingbiotechnologypharmacymedical codingbiomedical engineeringbotanyzoologybsc biotechbiotech engineer

Food Science & Processing
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Kurnool, Qatar, Bangalore, Kuwait, Noida, Philippines, United A 22 Jul, 2026

A Food Science & Processing professional culinarytrialssupporttechnicalspecificationsdevelopmentmanagementsafetyfoodprojectpilotplantproduct

Data Science Internship in Ahmedabad
MAXGEN TECHNOLOGIES PRIVATE LIMITED 1.00 to 10.00 Years Rajkot, AhmedabadAhmedabad, Gandhinagar, Patan, Gandhidham, Mehsana 22 Jul, 2026

Maxgen Technologies Pvt ltd offers live project internships in ahmedabad. Freshers and Students will getdata science internshipwith machine learnin...
machine learninginternshipdeep learning

Junior Research Fellow
National Institute of Technology Raipur 1.00 to 10.00 Years Raipur 22 Jul, 2026

The National Institute of Technology Raipur (NIT Raipur) has officially released the notification to fill the vacancy for 01 Junior Research Fellow post. Interested and eligibile candidates can us...
MCAMScComputer ScienceElectronicsEngineeringBEB Tech

Full Stack Developer/ Node.js
SSInformatics Software solutions pvt ltd 1.00 to 10.00 Years Raipur 22 Jul, 2026

Job Title: Full Stack Developer (Minimum 1 Year Experience) Company: SS Informatics Job Location: Bhilai, Chhattisgarh Experience Required: Minimum 1 Year Employment Type: Full-Time About Us SS...
PHPLaravelHTML5CSS3JavaScriptBootstrapMySQLMongoDBNodejs

Senior Qa Engineer
BASUDHAMAX MULTITRADE PRIVATE LIMITED 1.00 to 10.00 Years Noida, DelhiDelhi, Zimbabwe, Mozambique, Afghanistan, Bangalore, Chennai, Hyderabad, Kolkata, Gurugr 22 Jul, 2026

We are looking for an experienced senior QA engineer to oversee our quality assurance team. You will be required to oversee all aspects of software and product testing within the company. This ma...
test automationtransportation managerproduction managerforklift operatorproduction schedulershift supervisorfactory managerprocess managersenior qa engineer

System Engineer Dynatrace
LTM 1.00 to 10.00 Years Delhi, BangaloreBangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Coimbatore 22 Jul, 2026

Job Title: System Engineer Dynatrace (Observability)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noid...
dynatraceharnesssystemawsengineer

PRT SST Teacher
Educare Ventures Private Limited Hiring For CBSE school 1.00 to 10.00 Years Noida, Ghaziabad 22 Jul, 2026

Excellent opportunity as PRT - SOCIAL SCIENCE from a well reputed & established CBSE affiliated school located at Noida. Position: PRT - SOCIAL SCIENCE [F] S...
social sciencesocial studiesprt sstpgt sst

DevOps Engineer (Kubernetes Terraform)
LTM 1.00 to 10.00 Years Noida, DelhiDelhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 22 Jul, 2026

Job Title: DevOps Engineer (Kubernetes Terraform)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida,...
kubernetesdevopsengineerterraform

MERN Stack Developer (12 Years Experience)
CodeXstream 1.00 to 10.00 Years Mohali 22 Jul, 2026

About the Role We are looking for a passionate MERN Stack Developer with 12 years of hands-on experience to join our team in Mohali. The ideal candidate should have a strong foundation in modern ...
JavaScriptMongoDBHTML5CSS3MERN StackReactjsNodejsExpressjsGitGitHub

for Optometry & Genetics
ACHIEVERS SPOT Hiring For medical coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Erode, Coimbatore, Chennai, Salem, Kanyakumari, Nagapattinam, Theni, Cu 22 Jul, 2026

The Optometry & Genetics Specialist is responsible for integrating advanced eye care with genetic science to support the diagnosis, evaluation, and management of inherited and acquired ocular con...
biologybiotechnologychemistryoptometrybiochemistrybiomedicalgenetics

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

for Optometry & Genetics
ACHIEVERS SPOT Hiring For medical coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Erode, Coimbatore, Chennai, Salem, Kanyakumari, Nagapattinam, Theni, Cu 22 Jul, 2026

The Optometry & Genetics Specialist is responsible for integrating advanced eye care with genetic science to support the diagnosis, evaluation, and management of inherited and acquired ocular con...
biologybiotechnologychemistryoptometrybiochemistrybiomedicalgenetics

Wanted Biomedical Engineer
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Nagercoil, Thiruvarur, Dharmapuri, Theni, T 22 Jul, 2026

DESCRIPTION
As a Biomedical Engineer, you will play a crucial role in developing and improving biological products and processes. Your responsibilities will include: ...
nursingbiomedical engineeringbioinformaticsvirologymedical codingpharmacybiopharmaceuticalsbiotechnologymicrobiology

MERN Full stack developer
Hello Technologies 1.00 to 10.00 Years Madurai 22 Jul, 2026

Company: Hello Technologies Location: Madurai Experience: 13 Years Employment Type: Full-Time Job Summary We are looking for a skilled MERN Stack Developer with hands-on experience in developing...
MongoDBJavaScriptHTML5CSS3BootstrapExpressjsReactjsNodejsREST API Integration

for Anaesthologist & Biochemist
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Coimbatore, Chennai, Salem, Pudukottai, Kanchipuram, Tuticorin, Cuddalo 22 Jul, 2026

DESCRIPTION
As an Anesthetist, you will play a crucial role in patient care, ensuring safety and comfort during surgical and medical procedures. Your primary responsi...
nursingchemistryanesthesiabiochemistrycardiac anaesthesiaparamedicalperfusion techpharmacistlife science

Medical Coding Analyst
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Madurai, TiruchirappalliTiruchirappalli, Erode, Chennai, Thirunelveli, Salem, Nagercoil, Tuticorin, 22 Jul, 2026

Position:Medical Coder About Achievers Spot Medical Coding is the Fastest-growing Profession in the Healthcare Industry Today. It is a Niche Specialization and...
physiotherapybiotechnologymedical codingbiomedicalpharmacynursingmedical lab technologymedical coding analystmedical coding executive

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

DevOps Engineer (Kubernetes Terraform)
LTM 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi 22 Jul, 2026

Job Title: DevOps Engineer (Kubernetes Terraform)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida,...
kubernetesdevopsengineerterraform

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

Assistant IT Admin
Elance Learning 1.00 to 10.00 Years Kochi 22 Jul, 2026

Department: Information Technology Reports To: IT Manager / Head of IT Employment Type: Full-Time Job Summary We are seeking a proactive and detail-oriented IT Assistant to support the day-to-...
IT supportsystem administrationnetworkingtroubleshootingcommunication skillsantivirusfirewallprioritizationcybersecurity

IBM Netezza Administrator
LTM 1.00 to 10.00 Years Hyderabad, BangaloreBangalore, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Coimbatore 22 Jul, 2026

Job Title: IBM Netezza Administrator
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida, Coimbatore <...
dmlnetezzaddldba

DevOps Engineer (Kubernetes Terraform)
LTM 1.00 to 10.00 Years Hyderabad, BangaloreBangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi 22 Jul, 2026

Job Title: DevOps Engineer (Kubernetes Terraform)
Experience: 8-14 Years Location: Mumbai, Pune, Chennai, Hyderabad, Bengaluru, Kolkata, Delhi, Noida,...
kubernetesdevopsengineerterraform

PREV
NEXT

actuarial science Job Openings

DESCRIPTION

Job Description .NET Developer (Banking Domain)

Job Title: System Engineer Dynatrace (Observability)

Job Title: IBM Netezza Administrator

Key Responsibilities kubernetesaws

Job Title: DevOps Engineer (Kubernetes Terraform)

DESCRIPTION

Job Title: System Engineer Dynatrace (Observability)

Job Title: DevOps Engineer (Kubernetes Terraform)

DESCRIPTION

DESCRIPTION

DESCRIPTION

DESCRIPTION

Job Description

Job Title: DevOps Engineer (Kubernetes Terraform)

Job Title: IBM Netezza Administrator

Job Title: DevOps Engineer (Kubernetes Terraform)

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Key Responsibilities

kubernetesaws