analytical problem solving abilities dot jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

analytical problem solving abilities dot Job Openings

Showing 45801 - 45850 of 48359 Jobs

Java Springboot Lead

Infosys Limited 2.00 to 6.00 Years Mysore 12 Oct, 2023

software development methodologies

IT Testing

Infosys Limited 1.00 to 2.00 Years Mysore 12 Oct, 2023

delivery of projects

client interfacing skills

Inside Sales Representative

Golden Red Consulting Private Limited 0.00 to 4.00 Years Mumbai City 12 Oct, 2023

Inside Sales Executive for a parenting company

Responsibilities:

inside sales

professional counseling

Payment Poster, Charge Poster, US Healthcare

AM Medical IT Solutions 0.00 to 1.00 Years Mumbai City 12 Oct, 2023

charge posting

payment posting

rcm training

IT Business Analyst-Web & Mobile Applications (Leading MNC Company) Mumbai

Vertex Corporate Services India Pvt Ltd 5.00 to 7.00 Years Mumbai City 12 Oct, 2023

Role:

- Performing detailed requirements analysis, documenting processes, and performing some user acceptance testing.

- Managing projects, developing ...
mobilewebasp.netsqlbusiness analyst

Senior Business Development Manager
Shri Management Services Hiring For Shri Management Services 4.00 to 9.00 Years Mumbai City 12 Oct, 2023

We are seeking a skilled and motivated Business Development Manager to join our roofing company specializing in roof shingles and stone-coated metal roofs. As the Business Development Manager, you...
roofingstone coated metal roofs

Product Trainer
JOBSPOT HR SERVICES 5.00 to 10.00 Years Mumbai City 12 Oct, 2023

Our Client a 50 year old Engineering and Manufacturing based at Sakinaka, Andheri E, Mumbai needs - Post : Product Trainer Location : Sakinaka, Andheri E, Mumbai Qualification : B.E. Mechanica...
dealer trainingproduct trainingtechnical trainingindustrial training

Network Engineer
ARYAN TECHNOLOGY 0.00 to 4.00 Years Mumbai City 12 Oct, 2023

Network Engineer Job Responsibilities:

Establishes and maintains network performance.

Builds net configurations and connections.

Troubleshoots netw...
ccnptroubleshootingccienetworkingccnaroutersswitches

Operations Manager
Talent Corner HR Services Pvt Ltd 5.00 to 7.00 Years Mumbai City 12 Oct, 2023

Operations Manager who is presentable, knows English & Hindi and has an experience of over 5 years in the security business Experience & Qual...
security managementsecurity servicesfacilities operations

Oracle EBS SCM Manufacturing
LTIMindtree Limited 6.00 to 11.00 Years Mumbai City 12 Oct, 2023

LTIMindtree is hiring for Oracle EBS Practice. Exp required: 6 to 12yrs Location: PAN India(All LTI Offices) NP: Immediate to 45 days Detail JD:

The EBS - Mfg (Advanced) Functional...
oracle manufacturingwarehouse management systemsoracle scmoracle ebsmanufacturing moduleoracle warehouse managementoracle order managementsupply chain management

Financial Analyst
Fiserv India Pvt Ltd 2.00 to 4.00 Years Thane 12 Oct, 2023

JOB PURPOSE: Seeking a driven, career focused finance professional - the primary focus of this role is to help perform critical finance activities and analysis to drive profitable busine...
accounts payablegeneral ledgercustomer relationscredit reportingsap bpcreportingaccounts

Cloud OTM Consultant
LTIMindtree Limited 5.00 to 10.00 Years Mumbai City 12 Oct, 2023

Position Cloud OTM/GTM (Oracle Transportation Management/Global Transportation Management) Experience - 6 to 12 Years Notice period - 0- 45 Days Max Job location - Bangalore Technical Expert...
oracle transportation managementotmgtmfusion otmsaas otmcloud gtmglobal transportation managementcloud otmfusion gtm

Fusion PPM Consultant
LTIMindtree Limited 6.00 to 11.00 Years Mumbai City 12 Oct, 2023

Position Fusion PPM (Project Portfolio Management) Experience - 5 to 12 Years Notice period - 0- 45 Days Max Job location - LTIM India offices, Job Summary: We are looking for an experience...
project portfolio managementppmcloud project portfolio managementsaas ppmfusion ppmfusion project portfolio managementcloud ppm

Junior Accounts Assistant
Decano Consulting 1.00 to 6.00 Years Navi Mumbai 12 Oct, 2023

We are looking for a Junior Accountant, you will be working on UK company accounts. Assisting the Senior Accountant Ensure maintenance of books of accounts wit...
cash flowdouble entry

Urgent Requirement for Telecaller with a Renowed Banking Group for Metro Cities
Hinduja Global Solutions Limited (HGS) 0.00 to 2.00 Years Mumbai City 12 Oct, 2023

Primary Responsibility: Contacting current and potential clients to inform them regarding the product and service. Answering all queries and questions regarding the company and product. Understa...
customer caretelecallingcustomer support

Relationship Manager-BFSI Field Sales
TEKPILLAR 2.00 to 6.00 Years Mangalore 12 Oct, 2023

Summary:

We are a rapidly expanding BFSI business committed to offering our customers first-rate financial services. We are looking for a business l...
marketingpharmabfsimanagementsaleshealthleadloan

Urgent Hiring For Accountant, Cashier, Banking Operation, Finance Analyst
Kartik Kumar Joshi Hiring For Gita Consultancy 0.00 to 1.00 Years Kochi 12 Oct, 2023

Accountant Responsibilities:- Complying with the company, state, and country accounting and financial regulations. Compiling, analysing, and reporting financial data. Creating...
account managementaccountingbanking productscashiersbanking operationscash handling

Content Design Dev-Ops
IBM India Pvt Limited 0.00 to 4.00 Years Kochi 12 Oct, 2023

Introduction At IBM, work is more than a job it s a calling: To build. To design. To code. To consult. To think along with clients and sell. To make markets. To invent. To collaborate. Not just to...
software development life cyclesoftware development toolsfront endbash scriptingcontent designagile developmentdevelopment toolsdigital conversionsoftware developmentsoftware engineeringintellectual propertywritten communicationstrategic initi

Release Manager
IBM India Pvt Limited 3.00 to 5.00 Years Kochi 12 Oct, 2023

As a Release Manager you will be responsible for implementing and managing the release process from development to testing then finally to the production environments. Responsibilities
release managementchange managementagileitiljavadata preparationtechnical supportsoftware developmentsoftware engineering

Hired for _ Software Development Engineer
GFL RECRUITMENT PRIVATE LIMITED 4.00 to 5.00 Years Kochi 12 Oct, 2023

Dear Candidate, Were Hiring for Software Development Engineer 3 Backend Engineer Roles & Responsibilities :- Thisis an inciden...
backendsoftware development engineer

Junior Accountant
ELITERECRUITMENTS Hiring For Banking 0.00 to 3.00 Years Kochi 12 Oct, 2023

EliteRecruitments Hiring For Banking Junior Accountant Job Description he candidate youll end up hiringshould have...
branch managementaccountingtaxation

Next.JS Developer
People First Consultants Pvt Ltd 3.00 to 8.00 Years Kochi 12 Oct, 2023

Greetings ! This is Nivetha Shankar from People First Consultants. We have great pleasure in sending this email from People First Consultants, a firm that specializes in Top Management placemen...
react.jsdevelopers

Assistant Officer
Krishna Consultancy Hiring For Reliance Industries Ltd 8.00 to 13.00 Years Kanpur 12 Oct, 2023

An assistant is responsible for the smooth and efficient running of an office through performing administrative and clerical duties, as well as providing reliable support for managers, staff, and...
emotional intelligenceorganizationtime managementtechnologycommunication skillsproblem solving

Supply Chain Director
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Supply Chain Manager [Intro Paragraph] The most effective logistics manager job descriptions use the first 2-3 sentences to introduce your company to prospectiv...
problemleadership skillsemotional intelligenceexecutive managementexecutive developmentcommunicationtime managementorganisationskills.

Sr. Planner
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Hyderabad 12 Oct, 2023

Job brief We need a qualified Senior Production Planner to organize production in accordance with requirements and quality requirements. You will be responsible...
analysisdecision-makingmanagementrisksupplystrategycommunicationlogisticstimechaindata

Senior Process Executive
Infosys Limited 0.00 to 1.00 Years Hyderabad 12 Oct, 2023

Proficiency in AutoCAD 3D application is required. Experience in working with utilities projects is must. Good knowledge and understanding of GIS, Field maps and related areas. Experience of wor...
customer relationsaccountsslaqualityinsurancems officeautocad 3dcustomer serviceverbal communicationgismapsarcgisautocadoutlookutilitiesanalyticalpresentationcommunication

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Hyderabad 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Java Senior Consultant
Infosys Limited 2.00 to 6.00 Years Hyderabad 12 Oct, 2023

We are looking for a Java technical Consultant with experience on Springboot as well, who will be responsible for building applications and leading development teams. Will have to leverage his or ...
sapcustomer relationsdeliverysalessqlteam leading skillslife cycleteam leadinguser requirementsproduct developmentcommunication skillsdevelopment projectswritten communicationhisjavacodesdesignfeaturesconsulting

AWS/ Amazon Web Services Developer
Infosys Limited 2.00 to 5.00 Years Hyderabad 12 Oct, 2023

Skills: AWS Nice to Have Skills: Python, Pyspark, Java, SQL, ETL, Hadoop , AWS certification Technical & Professional requirements: AWS, DataBricks, AWS Redshift Experience in Building AWS stack u...
project life cyclesoftware quality assurancedynamo dblife cycleweb servicesdata modelingtesting toolscloud storagedata migrationcloud securityproblem solvingtechnical skillssoftware qualityissue resolutionquality assurancesolution delivery

GCP Architect
Infosys Limited 5.00 to 17.00 Years Hyderabad 12 Oct, 2023

A day in the life of an Infoscion As part of the Infosys delivery team, your primary role would be to provide best fit architectural solutions for one or more projects. You would also provide tech...
problem solvingdesign patternsperformance tuningthought leadershiparchitectural designsolution developmentdigital transformationcompetency developmentfitsdlcclouddesignsizingdatabasecomplianceleadershipperformancearchitectureconsultation

.Net Project Manager
Infosys Limited 5.00 to 13.00 Years Hyderabad 12 Oct, 2023

We are seeking a highly experienced .NET Project Manager to join our team. As a Project Manager, you will be responsible for leading and managing the development of .NET projects from start to fin...
deliveryproject managementcustomer relationsreportingjavasubject matter expertsidentifying new opportunitiessoftware development methodologiesproject planscloud computingproblem solvingversion controlproject planningagile methodologiessoftwa

Software Engineer
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Our company is seeking a talented Software Engineer to join our team. As a Software Engineer, you will be responsible for designing, developing, and maintaining software solutions that meet the n...
softwaresoftware engineeringdevelopmentsoftware engineers

Hire for _Software Engineer
MNR Solutions Pvt Ltd 1.00 to 5.00 Years Delhi 12 Oct, 2023

Design, implement, and maintain software systems using Typescript, React, AWS, Docker, and Node/Express.

Work with little to no oversight to rapidly deliver softwar...
software engineerssoftware engineeringsoftware development

Senior Data Scientist
Nustar Technologies India Private Limited Hiring For Nustar Technologies India Private Limited 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Job Purpose and primary objectives: To manage a team ofdataanalysts/scientists for the delivery of insights for several...
machine learningpythonnumpy

Store Manager
Garima Interprises Hiring For Garima Interprises 1.00 to 6.00 Years Gurugram 12 Oct, 2023

A store manager is responsible for overseeing the daily operations of a store, making sure it runs smoothly and effectively. Their duties include motivating sales teams, creating business strateg...
customer servicecommunication skillsproblem solvingdecision-makingretail

Requirement for Scientific Administrative Assistant position
Amity University 5.00 to 7.00 Years Noida 12 Oct, 2023

Applications invited for Scientific Administrative Assistant position AFAF 25-04-2023 - Adv/AUUP/HR/23/225 Advertisement Date: 25-04-2023 Adv/AUUP/HR/23/225 Amity Food & Agriculture Foundation Inv...
analyticalresearchadministration

Operation Associate
SAFE LEDGER PRIVATE LIMITED Fresher Gurugram 12 Oct, 2023

About the Company: Registerkaro is a leading provider of finance accounting and taxation services, dedicated to assisting businesses in their formation and compliance needs. We o...
operationsfinancial reporting

SR. SALES MANAGER
GFL RECRUITMENT PRIVATE LIMITED Hiring For Verpaco Ltd 2.00 to 6.00 Years Delhi 12 Oct, 2023

We are seeking an experienced and highly motivated HORECA Sales Business Operations Senior Manager to join our team. The ideal candidate should have a solid background in sales and business oper...
business developmentsaleslead generationdemand generation

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Gurugram 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

Urgent Requirement Of Work From Home Form Filling | Data Entry | SMS
Fondstaff Private Limited 0.00 to 2.00 Years Gurugram 12 Oct, 2023

The company has 3 types of part-time work from home: Handwriting, SMS sending, and Captcha Entry. Only captcha entry job you need to Internet and more two jobs no any need for Internet. HOME-BAS...
data entrysmsonline work from homepart time work from homework from homeonline data entrypart time freelance

Android Developer
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 4.00 to 5.00 Years Gurugram 12 Oct, 2023

Job Role – Android developer (mobile devices and TV). Preferred domain experience: OTT , Media , Video , Audio space Good analytical ability to attack problems that are very unusual and ex...
AndroidAndroid StudioJavaAndroid frameworkJavaJavaJavaScriptJSONHTMLKotlinFireTv

Sales Analyst
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Gurugram 12 Oct, 2023

Sales analysts analyze sales data, create sales forecasts, and make recommendations to optimize sales activities and increase market share. Sales Analyst Responsibilities: Compiling, analyzing,...
communication skillsorganizationproblem solvingleadershiptime management

Finance Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Gurugram 12 Oct, 2023

Finance managers are business specialists who manage important financial functions of an organization. They produce financial reports, manage investment activities, and create strategies and plan...
organizationproblem solvingdecision-makingmathematicscommunication skills

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

Hotel Steward
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are looking for a hard-working steward to be responsible for ensuring all sanitation standards are met. The steward will attend to customer needs, assist wait staff, ensure all stations are we...
servicepressurereliabilitycommunicationteamworkmechanicalcustomerabilitiesdetailphysicalunderattentionproblem-solvingorganisationalabilitywork

Area Sales Manager
Nimmi Enterprises 1.00 to 6.00 Years Delhi 12 Oct, 2023

Hello Hope You Are doing great.! I am hiring Urgent requirements for Area Sales Manager (B2B) . If you are comfortabl...
fmcg operationsmarketing managementfmcg salesmarketingfmcg marketingb2b marketingsales managementasmsales

Technical Sales Representative
Job Search 1.00 to 4.00 Years Delhi 12 Oct, 2023

HI, we have an urgent job opening for a position of Technical sales Representative postion with one of our client who are the leading distributors of Raw material , chemicals used in Pharma , co...
chemical salesapisalesflavorscoatingdyespigmentspaintsmaterial

Fragrance developer
NUPLANET VENTURES INDIA PRIVATE LIMITED 2.00 to 5.00 Years Delhi 12 Oct, 2023

1.Perfumer: This is one of the most traditional and widely recognized titles for fragrance developers. Perfumers are responsible for crafting unique and appealing scents for vari...
perfumesanalyticalfragrance

Hr Generalist
Big Bee Consultant 3.00 to 5.00 Years Noida 12 Oct, 2023

Job Opening : HR Generalist

Location : Noida Sec -5

Supervisory Responsibilities:

May...
hr operationshr generalist activities

Salesforce Commerce Cloud Lead Developer
HCL Technologies Ltd 5.00 to 10.00 Years Noida 12 Oct, 2023

Hi All, Greetings! HCL Technologies Pvt Ltd. India, we are hiring for the below job role Location : Bengaluru/Hyderabad/Chennai/Pune/Noida Primary Skill :B2B Commerce (Cloud Craze) .
<...
lightingvisualforceapex data loadersalesforcearchitectural lighting

PREV
NEXT

analytical problem solving abilities dot Job Openings

Supply Chain Manager [Intro Paragraph] The most effective logistics manager job descriptions use the first 2-3 sentences to introduce your company to prospectiv... problemleadership skillsemotional intelligenceexecutive managementexecutive developmentcommunicationtime managementorganisationskills.

Job brief We need a qualified Senior Production Planner to organize production in accordance with requirements and quality requirements. You will be responsible... analysisdecision-makingmanagementrisksupplystrategycommunicationlogisticstimechaindata

Job Opening : HR Generalist

Location : Noida Sec -5

Supervisory Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Supply Chain Manager [Intro Paragraph] The most effective logistics manager job descriptions use the first 2-3 sentences to introduce your company to prospectiv...
problemleadership skillsemotional intelligenceexecutive managementexecutive developmentcommunicationtime managementorganisationskills.

Job brief We need a qualified Senior Production Planner to organize production in accordance with requirements and quality requirements. You will be responsible...
analysisdecision-makingmanagementrisksupplystrategycommunicationlogisticstimechaindata