collaboration on hr projects jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

collaboration on hr projects Job Openings

Showing 23951 - 24000 of 37486 Jobs

Landscape Architect

Millenial Impact Services 1.00 to 6.00 Years Delhi,Faridabad 29 Oct, 2024

Landscape Design: Develop creative landscape designs that integrate with architectural projects, ensuring harmony between structures and nature.
...
autocadarchitecture

Manager Admin & Operations
FRONTLINE TECH JOB CONSULTANTS 10.00 to 20.00 Years Delhi,Dehradun, Gurugram, Chandigarh, Ahmedabad 29 Oct, 2024

Job Description

The Administrative Manager will be responsible for overseeing the daily administrative operations of the company, managing the administrative staff, and ensur...
operationsadministration

Civil & Mechanical Engineer
The JSM Engineers 0.00 to 2.00 Years Delhi,Noida, Other Kerala, Pune, Mumbai City 29 Oct, 2024

Job Details:

Required Experience: 0-2 Yrs

Required Locations: Mumbai, Pune, Kerela, Noida, Delhi

Salary: 16hidden_mobile site supervisionproject managementcivil site engineeringmechanical engineeringsite executionmechanical maintenancemechanical designsite engineering

Graduate Engineer Trainee
VANTEK INDIA ASSOCIATES Fresher Delhi,Noida, Gurugram 29 Oct, 2024

Graduate Engineer (Fresher) Location:Delhi / NCR We are seeking a motivated and enthusiastic Graduate Engineer to join our team. This is an entry-level positio...
testingproduction

Strategy & Business Development - Power Sector
Jobsplan dot com 9.00 to 14.00 Years Delhi,Faridabad, Ghaziabad, Noida, Gurugram 29 Oct, 2024

Manager / Sr. Manager - Strategy & Business Development (Policy Strategist) Location: Delhi Job Role: - Opportunity Identification:Lead effor...
power sectorbusiness developmentpublic affairsrenewable energyregulatorycorporate affairssales

Project Manager Civil
FRONTLINE TECH JOB CONSULTANTS 10.00 to 20.00 Years Delhi,Noida, Bangalore, Lucknow, Kolkata 29 Oct, 2024

Job Description
Role & responsibilities The project manager plays a pivotal role, responsible for the successful planning, execution, and closure of construction proj...
engineeringconstruction managementcivil engineering

Executive-Accounts & Finance
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 7.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 29 Oct, 2024

Responsibilities:

Update Tally entries and generate Excel sheets.

Produce daily financial reports using advanced Excel.

Post and process journal entries to record a...
tds calculationtallyoperationsbank reconciliationexcel reporterpmispreparationtdsprocurementfinancial reporting

Hr Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 29 Oct, 2024

Support the automation of various HR processes and workflows to improve efficiency and reduce manual efforts.

Collaborate on system integrations between HR tools and...
internshipreport generationresearchautomationhr processesfocushr policies

Pipeline Engineer
OVERNET TRADING PRIVATE LIMITED 21.00 to 25.00 Years Faridabad,Ghaziabad, Mohali, Ambernath, Navi Mumbai, Ahmednagar, Aurangabad, Jalgaon, Nagpur, Port B 29 Oct, 2024

Were looking for a Pipeline Engineer who is passionate about their work and takes pride in delivering high-quality results. The ideal candidate will have a strong technical background and be able...
powersafetypipelinetrainingfirehsecadbillingmechanicroustaboutinspectorengineerleadsupervisoradministratorplanttrainertechniciancoordinator

Financial Analyst
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 29 Oct, 2024

Develop Financial Models: Build and maintain complex financial models to forecast future financial performance, analyze investment opportunities, and assess potential ri...
advanced excelbank reconciliationoperationstds calculationfinancial reportingtallymis reporting procurementexcel report

Group Project Coordinator - Language (Basque)
CONSULTBAE INDIA PRIVATE LIMITED 0.00 to 2.00 Years Gurugram 29 Oct, 2024

Language (Basque) Group Project Coordinator Read, Speak & Record Task Language -Basque Remote - Short Opportunity ...
languageproject coordinator

Group Project Coordinator - Language (Icelandic )
CONSULTBAE INDIA PRIVATE LIMITED 0.00 to 2.00 Years Gurugram 29 Oct, 2024

Language (Icelandic ) Group Project Coordinator Read, Speak & Record Task Language - Icelandic Remote - Short Opportunity ...
languageicelandic

Pipeline Engineer
OVERNET TRADING PRIVATE LIMITED 21.00 to 25.00 Years Faridabad,Ghaziabad, Mohali, Ambernath, Navi Mumbai, Ahmednagar, Aurangabad, Jalgaon, Nagpur, Port B 29 Oct, 2024

Were looking for a Pipeline Engineer who is passionate about their work and takes pride in delivering high-quality results. The ideal candidate will have a strong technical background and be able...
powersafetypipelinetrainingfirehsecadbillingmechanicroustaboutinspectorengineerleadsupervisoradministratorplanttrainertechniciancoordinator

Chartered Accountant (CA)
HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 3.00 to 7.00 Years Delhi 29 Oct, 2024

Financial Reporting: o Prepare and review financial statements, reports, and forecasts. o Ensure accuracy and compliance with accounting standards and regulations. o Conduct monthly, quarterly, ...

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Manager - Engineering
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 29 Oct, 2024

As an Engineering Manager, you will play a key role in researching and developing innovative products. You will also be responsible for creating project budgets and overseeing their successf...
developmentplcinstrumentationdcsmodbusresearchprocess automation

Technical Writer
MNR Solutions Pvt Ltd 6.00 to 11.00 Years Delhi 29 Oct, 2024

Attend client meetings and actively participate in discussions to gather technical information and requirements related to consumer electronics product development. Take meticulous notes during ...
technical communicationwriting skillsinstallationproduct specification

Liaison Executive
Hunarmand India Private Limited 1.00 to 5.00 Years Delhi,Noida 29 Oct, 2024

Promoting projects:Promoting ideas and projects
<...
government operationsgovernment liasioning

Computer Teacher
ANAGH MATCHMAKING SERVICES (OPC) PRIVATE LIMITED 1.00 to 4.00 Years Delhi 29 Oct, 2024

Duties and Responsibilities: Evaluates student performances in class and on tests and provides feedback. Creates lesson plans that are appropriate for the age and abilities of the students. A...
excelvideowebteacher trainingdevelopmentcomputeraccountingeditingeducation reformdigital marketingteacherfreelancerdesigneradvance

AthenaOne Systems Analyst Role (Pan India)
Wroots Global Private Limited 7.00 to 12.00 Years Delhi,Ghaziabad, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

We are currently looking for anAthenaOne Systems Analystto join our team in (Pan India). This role involves supporting, configuring, and troubleshooting the AthenaOne EMR system,...
emrathenacollectorclinicals

Salesforce CPQ - Lead (Wipro)
Wroots Global Private Limited 7.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

Immediate Joiners or 30 Days Notice period is preferred.

Minimum 5 years of experience in Salesforce Sales & CPQ Cloud or any other CPQ Product salesforcelwccpq

Technical Account Manager
TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Panchkula,Bangladesh, Panipat, Bangalore, Hisar, Chennai, Kurukshetra, Malaysia, Gurugram, Yamunanag 29 Oct, 2024

Responsible for customer satisfaction, retention and reference-ability for all assigned account.

Establish and maintain a technical rela...
technical supportoperationsbioprocess engineeringanalyticalprocess

Construction Supervisor
KINAL GLOBAL CARE PRIVATE LIMITED 10.00 to 20.00 Years Chandigarh,Surat, Puerto Rico, Oman, Tanzania, Uganda, Thailand, Balrampur, Philippines, Rajahmundry 29 Oct, 2024

Prepare project plans and carry them out. Create feasibility studies by analyzing engineering design, conducting environmental impact studies, and assembling data. * Determine project costs by c...
construction equipmentconstruction engineeringbuilding constructionengineering servicesproject engineeringconstruction chemicalsconstruction supervisionearthmovingsoil stabilization

Pipeline Engineer
OVERNET TRADING PRIVATE LIMITED 21.00 to 25.00 Years Mohali,Ghaziabad, Ambernath, Navi Mumbai, Faridabad, Ahmednagar, Aurangabad, Jalgaon, Nagpur, Port B 29 Oct, 2024

Were looking for a Pipeline Engineer who is passionate about their work and takes pride in delivering high-quality results. The ideal candidate will have a strong technical background and be able...
powersafetypipelinetrainingfirehsecadbillingmechanicroustaboutinspectorengineerleadsupervisoradministratorplanttrainertechniciancoordinator

Civil Project Manager
RENUKA INTERPRISES 0.00 to 4.00 Years Chandigarh,Oman, Qatar, Saudi Arabia, Nashik, Kuwait, Bokaro, United Arab Emirates, Other Uttarakhan 29 Oct, 2024

Manage all civil portions of projects to be performed. Manage all manpower needs. Monitor and manage job costs as well as maintaining project schedules. Construct schedules for all projects. Res...
civil engineeringproject managementautocadcivil 3d

Php Software Developer
NEWAGE CONVERGENCE INDIA PRIVATE LIMITED 2.00 to 5.00 Years Chandigarh,Delhi 29 Oct, 2024

Job Description for PHP developer:- Responsibilities

Understand, plan and write code to develop assigned module/project within given time frame
...
cakephpcodeigniter

Data Engineer
Future Solution Centre 4.00 to 9.00 Years Chandigarh,Mohali, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Patna, Ahmedabad, Guwahati 29 Oct, 2024

We are looking for an experienced data engineer to join our team. You will use various methods to transform raw data into useful data systems. For example, youll create algorithms and conduct sta...
team managementcommunicationproject managementadaptabilityinterpersonal communicationschedulingbusinessbudget managementintelligencetime management

Manager Admin & Operations
FRONTLINE TECH JOB CONSULTANTS 10.00 to 20.00 Years Chandigarh,Dehradun, Gurugram, Delhi, Ahmedabad 29 Oct, 2024

Job Description

The Administrative Manager will be responsible for overseeing the daily administrative operations of the company, managing the administrative staff, and ensur...
operationsadministration

Chief Executive Officer
Pecus Healthcare Pvt Ltd 10.00 to 14.00 Years Chandigarh 29 Oct, 2024

We are urgently hiring Chief Executive Officer for Chandigarh location. Responsibilities: Take lead across all aspects of the company and developing effective policies to make all departments wo...
Team LeadershipStrategic PlanningCommunication SkillsTeam BuildingCollaborationCrisis ManagementVeterinary Pharma Industry Knowledge

Hiring For SAP FICO consultant
Latisha Interprises 0.00 to 3.00 Years Chennai,Vellore, Nellore, Coimbatore, Dehradun, Jaipur, Bangalore, Kochi, United Arab Emirates, Kolk 29 Oct, 2024

This role involves working closely with clients to understand their financial processes and requirements and translating them into SAP system configurations. The ideal candidate should have exten...
operationssapstatistical modelingdata analysis

Quality Engineer
Prime Placement Vision Hiring For Prime Placement Vision Private Limited 0.00 to 4.00 Years Chennai,Oman, Qatar, Saudi Arabia, Ahmedabad, Bhubaneswar, Kuwait, Jaipur, United Arab Emirates, Hyd 29 Oct, 2024

The Quality Engineer is responsible for ensuring that products meet quality standards and specifications before they reach the customer. This role involves developing quality control processes, c...
quality assurance engineeringquality controlquantity surveyingquality managementquality assurance

DGM -HRBP
Saaki Argus and Averil Consulting 18.00 to 22.00 Years Chennai,Other Tamil Nadu 29 Oct, 2024

Job Responsibilities: As an Deputy General Manager, you will be responsible for: Hr Process, Policies & Strategies HR Innovation and HR Projects Talent Management - encompasses: Succession Pl...
Talent ManagementSuccession PlanningPerformance ManagementOrganizational DevelopmentOrganizational DesignOrganizational LeadershipTalent DevelopmentLeadership DevelopmentTalent EngagementHr ProcessPoliciesStrategiesHR InnovationHR ProjectsHR

Hiring for Senior Early Year Facilitator For Premium Pre School
HR Globe Recruitment Service 3.00 to 8.00 Years Chennai 29 Oct, 2024

Dear Candidates, Hiring for Senior Early Year Facilitator For Premium Pre School at Chennai Interested candidate kindly send your updated cv in HR Globe Recruitment service < toddlersteacher trainingclassroom managementcurriculum mappinglesson planningteaching

Junior Sales Executive
Futurehook Technologies Pvt Ltd 1.00 to 3.00 Years Chennai,Bangalore, Hyderabad 29 Oct, 2024

We are seeking a dynamic Junior Product Consultant to join our field sales team in Bengaluru. This role is ideal for a self-motivated individual with a strong understanding of smart hom...
kannadatravel salesfield salesnegotiationsales

Program Officer - Training
T AND M SERVICES CONSULTING PVTLTD 5.00 to 9.00 Years Chennai 29 Oct, 2024

Dear Candidate, Job Opportunity in leading company for the profile of Program Officer - Training. Please find below attached JD- Roles and Responsibilities

...
government project managementrural planningngoss

Senior Data Scientist
Taggd 7.00 to 9.00 Years Chennai,Bangalore, Pune, Nagpur 29 Oct, 2024

Purpose of the Position: We are seeking a talented and experienced Senior Data Scientist to join our growing team. The ideal candidate will have a strong background in su...
pythonmachine learningartificial intelligencebigdatadata science

Hotel Maintenance Manager
AES INDUSTRIAL PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Azerbaijan, Botswana, Qatar, South Africa, South Korea, Iraq, Bangalore, Idukki, Kochi, Hyde 29 Oct, 2024

We are looking for a Hotel Maintenance Manager to take care of our hotels infrastructure (e.g. buildings, electricity.) You will manage maintenance personnel and plan various renovation and repai...
hospitality suitesguest service managementhotel administrationcorporate hospitalityhospitality financeproperty management systemshospitality projectshotel management

Field Sales Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Chennai,Bangladesh, Vadodara, Ahmedabad, Gandhinagar, Bangalore, Gandhidham, Rajkot, Malaysia, Bharu 29 Oct, 2024

Responsibilities

Work in close collaboration with the sales team and senior area sales managers

Guide a team of area sales representatives to meet th...
sales order processingsales administrationfield salesb2b marketingmarketing operationslead managementorder processing

Senior Solutions Manager
OMEGA HEALTHCARE MANAGEMENT SERVICES PRIVATE LIMITED 10.00 to 16.00 Years Chennai,Bangalore 29 Oct, 2024

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales

Financial Analyst
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 8.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop Financial Models: Build and maintain complex financial models to forecast future financial performance, analyze investment opportunities, and assess potential ri...
advanced excelbank reconciliationoperationstds calculationfinancial reportingtallymis reporting procurementexcel report

Buyer (Commodity)
DOMNIC LEWIS PRIVATE LIMITED 3.00 to 7.00 Years Chennai,Bangalore 29 Oct, 2024

This role involves collaborating with global and regional teams to drive strategic purchasing initiatives and ensure the efficient, sustainable, and innovative management of the supply chain. Thi...
supplier managementcontractspurchaseindirectrenovationcontrolcapexcostconstructioncommodityglobal

Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Develop and execute marketing strategies to enhance brand awareness and promote real estate projects effectively.

Analyze market trends, competitor activities, and...
product promotionbrand awarenesscommercial marketingcommunication skillsreal estate marketing

Quality Management Process Architect
UST Global 12.00 to 22.00 Years Chennai,Bangalore, Kochi, Noida, Hyderabad, Pune, Thiruvananthapuram 29 Oct, 2024

Quality Management Process Architect/Process Consultant Location: Kochi/Trivandrum/Hyderabad/Bangalore/Chennai/Pune/Noida Notice Period: Immediate-30 days
...
six sigmaqms

Housekeeping Supervisor
NEW ERA LIFE CARE PRIVATE LIMITED 19.00 to 22.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

We are looking for a Housekeeping Supervisor to lead our team of room attendants and ensure we provide excellent customer service. Housekeeping Supervisor responsibilities include organizing emp...
oshacustomer servicefront deskguest satisfactionclean roomssafety hazardscleanlinessroom attendantsguest rooms

Java Architect
UST Global 12.00 to 22.00 Years Chennai,Kochi, Thiruvananthapuram 29 Oct, 2024

Java Architect Location: Chennai, Trivandrum,Kochi Notice: Immediate-30 Days We are seeking a highly experienced Java Architect with a proven track record in delivering large-s...
solution architecturejavasolution design

Event Planner
AES INDUSTRIAL PRIVATE LIMITED 7.00 to 12.00 Years Bangalore,Other Assam, Chennai, Other Andhra Pradesh, Gurugram, Pune, Delhi, Other Haryana, Other Bi 29 Oct, 2024

We are looking for a successful and enthusiastic Event Planner to produce events from conception through to completion. Event Coordinator responsibilities include providing outstanding customer s...
managementplanningtimeeventskillsdetail

Business Consultant
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 15.00 to 24.00 Years Bangalore,Mangalore, Anantnag, Latehar, Sheopur, Hyderabad, Kolkata, Gurugram, Ujjain, Pathanamthitt 29 Oct, 2024

We are looking for a qualified and motivated business consultant to assess and reform business operations, provide expert guidance, and implement projects. The business consultants responsibiliti...
analysisstrategyconsultingplanningbusinessdevelopmentmanagementmarketingstrategic

Ship Engineer
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 8.00 to 13.00 Years Bangalore,Chandrapur, Uttar Bastar Kanker, Chennai, Hyderabad, Kasargod, South Goa, Bhavnagar, Silva 29 Oct, 2024

We are looking for a precise marine engineer to manage the development of multiple maritime projects. In this role, you will oversee the research, design, and construction of marine vessels, infr...
warehouse operationsforklift operationoperations managementinventory managementlogistics managementsupply chain managementshippingwarehouse management systemsreceiving

Communications Assistant
NEW ERA LIFE CARE PRIVATE LIMITED 20.00 to 25.00 Years Bangalore,Ongole, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Communications Assistant to provide administrative support to various teams and programs. Editing and writing company materials will be an important part of your job. In thi...
webdeskresolutioncontentcustomerpresstelephoneresidentialconflictfrontserviceadministrativelifecallsreleases

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

PREV
NEXT

collaboration on hr projects Job Openings

Job Description

Job Description

As an Engineering Manager, you will play a key role in researching and developing innovative products. You will also be responsible for creating project budgets and overseeing their successf... developmentplcinstrumentationdcsmodbusresearchprocess automation

Job Description

Responsibilities

Job description Solution Development Skill sets Required. Domain expertise in either of the areas: Real World Data solutionspresales

... six sigmaqms

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

As an Engineering Manager, you will play a key role in researching and developing innovative products. You will also be responsible for creating project budgets and overseeing their successf...
developmentplcinstrumentationdcsmodbusresearchprocess automation

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales

...
six sigmaqms