credential theft investigation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

credential theft investigation Job Openings

Showing 51 - 100 of 1480 Jobs

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Noida, Nepal, Hyderab 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Nepal, Hyderaba 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Marketing Executive

International Certification Services Pvt Ltd 1.00 to 10.00 Years Delhi, ChennaiChennai, Hyderabad 14 Aug, 2026

sales presentations

business-to-business

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Chennai, EthiopiaEthiopia, Bangladesh, South Africa, Bangalore, Noida, Nepal, Hyderabad, Kolkata, Un 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Marketing Executive

International Certification Services Pvt Ltd 1.00 to 10.00 Years Chennai, HyderabadHyderabad, Delhi 14 Aug, 2026

sales presentations

business-to-business

Security Supervisor

FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Ahmedabad, AnkleshwarAnkleshwar, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Udupi, Gurugram, Fa 14 Aug, 2026

communication

team management

technical hard skills

Cluster Medical Director Mumbai

Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City 06 Aug, 2026

REQUIRED SAFETY SUPERVISOR DABUR INDIA LIMITED

SUMIT KUMAR NEGI 1.00 to 10.00 Years Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Thane, Maharashtra, Bhubaneswar, Bokaro, Jharkhand 03 Aug, 2026

Contact Person :87,96,58,83,40 Rita Mam

Safety Supervisor Dabur India Limited (Job Description)

safetyregulatory complianceemergency responsesafety officer activitiesrisk managementsafety managementsafety trainingcommunicationsafety audit

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Mumbai City, PunePune, Vapi, Chennai, Noida, Hyderabad, Valsad, Delhi, Ahmedabad 03 Aug, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Returnship - TM-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a senior claims subject matter expert within a hybrid work model night shift environment applying deep knowledge of HIPAA claims adjudication and both provider and payer ope...
provider relationscustomer experienceuser acceptance testingHIPAA claims adjudicationproviderpayer operationshealth care claims processingHIPAA regulationsprovider reimbursement methodologiespayer domain expertise

Estate Manager
HR JOBS CONSULTANCY 1.00 to 10.00 Years Chandigarh, JaipurJaipur, Bangalore, Noida, Chennai, Hyderabad, Lucknow, Gurugram, Pune, Mumbai City 03 Aug, 2026

Estate Manager Farm & Estate Management Oversee the overall upkeep, development, and administration of the farm estate. Plan and supervise ...
estateestate management

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Chennai, NoidaNoida, Vapi, Hyderabad, Pune, Mumbai City, Valsad, Delhi, Ahmedabad 03 Aug, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Remote Senior Operations Analyst Data-Driven Insights & Resource Planning
remote next 1.00 to 10.00 Years All India 01 Aug, 2026

Join arenaflex Where Data Meets Innovation in the Travel Industry Are you reputed company to be part of a dynamic team thats transforming how a global leader serves millions of customers arenafle...
SQLPythonTableauanalytical skillscommunication skillsMS Officedata visualizationstatistical analysisproject management

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Pune, ChennaiChennai, Noida, Vapi, Hyderabad, Mumbai City, Valsad, Delhi, Ahmedabad 31 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Auditing Mgr- CS
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 31 Jul, 2026

Leading Financial services company requires Deputy Mgr/Mgr (Auditing and compliance)- - Mulund-Mumbai ( Only company secretary qualified need apply) One of our client a leading Financial servic...
company secretarial functionscompany secretarial workamalgamationcompanies actsebi regulations

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Hyderabad, PunePune, Mumbai City, Delhi 31 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
business developmentb2b marketing

Estate Manager
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Chandigarh, LucknowLucknow, Pune, Mumbai City, Delhi, Haridwar 31 Jul, 2026

Estate Manager Farm & Estate Management Oversee the overall upkeep, development, and administration of the farm estate. Plan and supervise agricultural, hortic...
majorproperty managementproperty acquisitionland acquisitiongovernment liaisonestate managementcolonellieutenant colonel

Walkin drive for Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 31 Jul, 2026

HCLTech | Walk-In Drive | Fraud Analyst | 1st Aug 26 | Bangalore Date: 1st Aug 26 (Saturday) Timing:<...
fraud analysisfraud investigationfraud managementfraud controlfraud detection

Assistant Hub Incharge
SHADOWFAX TECHNOLOGIES LIMITED 1.00 to 10.00 Years Bangalore 31 Jul, 2026

Role: Assistant Hub Incharge

Purpose of Role: To manage Manpower, handling escalations & metrics of their designated hub
Roles & Respon...
hublast mile

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 28 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Pune, HyderabadHyderabad, Mumbai City, Delhi 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
business developmentb2b marketing

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Noida, DelhiDelhi, Chennai, Vapi, Hyderabad, Pune, Mumbai City, Valsad, Ahmedabad 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Urgent | Health Claim Facilitator | Mumbai
Shree Balaji Employment Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

We Are Hiring Health Claim Facilitator Location: Mumbai Key Responsibilities:

Managed cashless and reimbursement health insurance c...
visitclaim investigationfield work

Estate Manager
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, DelhiDelhi, Pune, Mumbai City, Chandigarh, Haridwar 28 Jul, 2026

Estate Manager Farm & Estate Management Oversee the overall upkeep, development, and administration of the farm estate. Plan and supervise agricultural, hortic...
majorproperty managementproperty acquisitionland acquisitiongovernment liaisonestate managementcolonellieutenant colonel

Assistant Manager - Application Security
knowledge Artisan 1.00 to 10.00 Years Kochi 28 Jul, 2026

Were Hiring : Assistant Manager Application Security, IT Audit & GRC (2 Positions) Location : Kochi, Kerala Work Mode : On-site Employment Type : Full-Time Salary : Not a constraint for ...
Application SecuritySecure SDLCVAPTVulnerability ManagementGRCRisk ManagementSecurity ToolsIT Security AuditsERPApplication Security Reviews

Fraud Analyst AML KYC Banking Operations Chargebacks 1PlusYrs | Hyd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 28 Jul, 2026

Job Description (JD) Fraud Analyst | AML/KYC | Banking Operations Location: Hyderabad Experience: 14 Years CTC: Up to 4 LPA Shift: US Rotational Shift Notice Period: Immediate to 15 Days Pref...
Fraud InvestigationFraud DetectionAMLAnti Money LaunderingKYCFraud AnalystFraud Operations

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Ahmedabad, ValsadValsad, Vapi, Mumbai City, Chennai, Noida, Hyderabad, Pune, Delhi 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Delhi, NoidaNoida, Chennai, Vapi, Hyderabad, Pune, Mumbai City, Valsad, Ahmedabad 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Delhi, HyderabadHyderabad, Pune, Mumbai City 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
business developmentb2b marketing

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Ahmedabad, VapiVapi, Valsad, Chennai, Noida, Hyderabad, Pune, Mumbai City, Delhi 28 Jul, 2026

ICSPL is a company that provides inspection, testing, auditing, certification, training, and compliance services to organizations across industries such as manufacturing, engineering, constructio...
b2b marketingb2b marketing strategy

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ranchi, PatnaPatna, Bhubaneswar, Indore, Lucknow, Hyderabad, Navi Mumbai, Delhi, Bhopal 22 Jul, 2026

Chief Security Officer Position Summary We are looking for a highly disciplined and dynamic Chief Security Officer (CSO) to lead the end-to-end security operations. The incumbe...
security managementarmy retiredairforceindustrial securityvigilancedefencemilitary

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Inventory Control Manager
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, MoradabadMoradabad, Ghaziabad, Lucknow, Varanasi, Firozabad, Faizabad, Agra, Hyderabad, Kolk 22 Jul, 2026

An Inventory Control Manager team supervisiondatatechnicalanalysistime managementanalyticalforecastingskills

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

SOC & NOC Analyst
Muthoot Microfin 1.00 to 10.00 Years Kochi 22 Jul, 2026

Role & responsibilities Monitor alerts generated by SOC and NOC tools. Perform first-level analysis and ticket creation. Escalate incidents based on defined procedures. Monitor server, network...
Network Monitoring ToolsBasic NetworkingWindowsLinux FundamentalsSecurity Monitoring ConceptsEndpoint Security ToolsIncident Ticket ManagementBasic Cloud ConceptsCybersecurity FundamentalsSIEM Monitoring

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BhopalBhopal, Bangalore, Noida, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Purnia, Bangalore, Bhagalpur, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Ahmedabad, MundraMundra, Mumbai City, Varanasi, Pune, Delhi 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, NoidaNoida, Delhi, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Varanasi, DelhiDelhi, Pune, Mumbai City, Mundra, Ahmedabad 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Marketing Executive
International Certification Services Pvt Ltd 1.00 to 10.00 Years Chennai 22 Jul, 2026

International Certification Services Pvt. Ltd. is an established Conformity Assessment Body accredited by NABCB, JAS-ANZ, and EIAC to certify multiple management systems, including QMS, EMS, MDQ...
field salesb2b salesindustry mapping

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Bangalore, PurniaPurnia, Guntur, Bhagalpur, Chennai, Hyderabad, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

AGM - Downstream Processing
Cadila Pharmaceuticals Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Role Overview Department: DSP Designation: AGM Reporting To: General Manager Principal Tasks and Responsibilities Lead and supervise the downstream processi...
hplcanalytical developmentdownstream processing

Cyber Security Threat Detection and Response Operations Manager
Ernst & Young LLP ( EY India ) 1.00 to 10.00 Years Thiruvananthapuram 20 Jul, 2026

TC - CS - CDR - SOC - Manager At EY, were all in to shape your future with confidence. Well help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you w...
Security MonitoringCloud SecurityProject ManagementPerl scriptingSIEM technologiesCyber Incident ResponseIOTOTEndpoint ProtectionRegEx

PREV
NEXT

credential theft investigation Job Openings

Safety Supervisor Dabur India Limited (Job Description)

Role: Assistant Hub Incharge

Purpose of Role: To manage Manpower, handling escalations & metrics of their designated hub

Roles & Respon... hublast mile

Contact Person :97,17,22,36,28 Renu Mam

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Roles & Respon...
hublast mile