data protection regulations jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

data protection regulations Job Openings

Showing 33101 - 33150 of 81750 Jobs

Back Office Coordinator

Aspect Solution 0.00 to 1.00 Years Gwalior,Jhansi, Bangalore, Madurai, Chennai, Other Odisha, Nizamabad, Basti, Kohima, Tiruppur 01 Apr, 2025

part-time job opportunities

excel

typing

data entry

Procurement Assistant

SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

purchase operations

supplier quality assurance

Associat Customer Service

DREAMS SOLUTIONS 2.00 to 4.00 Years Gwalior,Ujjain, Indore, Pithampur, Khargone, Katni, Ratlam, Seoni, Sagar, Satna 01 Apr, 2025

cash transactions

service delivery

operations

customer service operations

banking

branch

cash handling

Posting Insurance Sales Manager

Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

agency development manager

sales officer

sales executive

Warehouse Supervisor

SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

Civil Engineer

Divya Staffing Solution 0.00 to 4.00 Years Gwalior,Ujjain, Indore, Bhopal, Katni, Balaghat, Sagar, Jabalpur, Rewa, Kuwait, United Arab Emirates 01 Apr, 2025

Product Manager

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Data Entry Operator

Fast Recruitment Services 1.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

back office

data entry

Data Entry Operator

V-Tech Data Outsourcing 0.00 to 1.00 Years Gurugram,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Navi Mumbai, Thane, Pune, Mumbai City 01 Apr, 2025

Quick and accurate typing and word processing skills
Accuracy and attention to detail
Integrity, discretion, and respect for...
handwriting work from homeexcel sheetwork from homedata analyticswork from home typingwork from home content writingtyping

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Field Sales Executive
TRAVELMAGNET INFOTECH PRIVATE LIMITED 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

About the Role: We are looking for energetic and customer-focused Field Sales Executives to drive merchant acquisition and promote digital payment solutions, specifically EDC (c...
field salessales

Ppc Head. .
Institute of Selection 10.00 to 12.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title: PPC Head Woven Fabrics Location: Gurugram Experience: 10 Years Industry: Textile / Woven Fabrics Manufacturing Salary: Negotiable Job Overview: we are a recruitment consultancy W...
ppcplanningproductionwoovenfabrics

Telecaller
THE TALENT KEEPERS 2.00 to 7.00 Years Gurugram 01 Apr, 2025

URGENT HIRING ! Profile-Telecaller Executive Company- Real Estate Location- Gurugram ROLES & RESPONSIBILITIES
customer careinbound processbpotelecallingcalling

Junior Engineer
Cynosure Corporate Solutions 2.00 to 5.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

ROLES AND RESPONSIBILITIES: Travel to allotted project site location for site survey, At site observe and report:

Measure the boundary of the site with use Googleapp....
equipmentsurveydatamappingsitehandlingcollectionsurveyinginspection

Design Manager
SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are currently searching for Design Manager oversees and coordinates the creative process of design projects, ensuring designs align with business goals, client needs, and project timelines, wh...
design patternsstrategic planningtechnical documentationsupervisory skills

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Data Entry from home - No Experience Needed
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear candidate, We are seeking a meticulous Data Typing Specialist to join our team. Skills Needed: Basic computer knowledge Work Conditions: No age bar, no work pressure, no targets. Both ma...
data entryexcelback office

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Sales Manager
Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

We are looking for a motivated Associate Agency Development Manager to support the recruitment, training, and growth of agency teams. The ideal cand...
marketingsales

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Tele Caller
Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title: Tele caller Location:Gurgaon Experience: 0-2...
bpolead generationcustomer relationship

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Purchasing Assistant
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Panaji 01 Apr, 2025

Job brief We are seeking a detail-oriented Purchasing Assistant to join our team. Your main responsibility will be to order supplies and equipment in accordance with our companys needs. This...
purchasepurchase requisitionengineeringengineering designengineering managementproject engineeringpurchase management

Automotive Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Guwahati 01 Apr, 2025

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Cnc Machinist
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Faridabad, Ambala, Hyderabad, Dhubri, Chandigarh, Bhillai, Silvassa, Guwahati 01 Apr, 2025

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Python API -Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Represent API Support with project teams to ensure that API knowledge is provided, thus ensuring effective support for new products and enhancements

Grow an up-to-date knowledg...
data visualizationgitlanguagecssapplication developmentpythonjavascriptchange managementdata structureshyperanalyticshtmlmarkup

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Data Entry Operator-Work From Home-Computer Work-Typing Work Fresher (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, were seeking a skilled data entry operator to join our data team. In this role, youll manage essential data input tasks, such as ensuring data accura...
work from homeback officefreelancingdata entrypart timehome based data entrytypingstudentsfresher

Urgent Vacancy for Primary Teacher
MATTRIXX INDIA 0.00 to 4.00 Years Gurugram,Delhi, Noida, Gandhinagar, Jaipur, Kolkata, Ranchi, Mumbai City, Bhopal, Patna 01 Apr, 2025

Job Title: Primary Teacher (Class 1-5)CBSE and ICSE boards Job Type: Full-time ( Work from Home )
management skillslesson planningcontent developmentquery resolution

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Part Time-Work From Home-Freelancing Computer-Data Entry Operator (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary on our company databases and computer systems. Data Entry Operator responsibilities include collecting a...
freelancingcomputer operatingdata entrypart timedata managementhomehome basedfresherfromwork

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Urgent Vacancy For Data Entry Operator (Work From Home)
MATTRIXX INDIA 0.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Vishakhapatnam, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are looking for candidates who are self- motivated and willing to work from home and have passion in Data Entry. We offer various types of data entries work: Excel Numeric ...
typing 40wpmdata entrytyping speedwork from homedata entry work from homedata entry operation

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Patna 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingonline data entrywork from homepart timedata entry

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Kochi, Hyderabad, Kollam, Thiruvanananthapuram, Mumbai Ci 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

PREV
NEXT

data protection regulations Job Openings

Job Description / Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

About Us:

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia... constructionautomobile engineeringautomobileconstruction managementengineering management

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i... cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering