data updation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

data updation Job Openings

Showing 44051 - 44100 of 68090 Jobs

Branch Operations Manager

Easy Hiring Solutions 2.00 to 5.00 Years Hyderabad,Bangalore, Chennai, Indore, Raipur, Tiruchirappalli, South Goa, Dibang Valley, Tadepalligu 12 Nov, 2024

Branch Operations Managersoversee operational activities at every level of an organization. Their duties include hiring and training employees and managing quality assurance programs. An ...
collateral managementoperational risk managementbackend operationsback office managementback office supportoperations researchoperational riskoperations managementback office operations

Junior Accountant
Easy Hiring Solutions 0.00 to 4.00 Years Hyderabad,Bangalore, Chennai, Idukki, Vijayawada, Kasargod, Vishakhapatnam, Belgaum, Hubli, Ahmedaba 12 Nov, 2024

An effective job title wiil typically include a general term, the level of experience and any special requirements. The general term will optimize your job title to show up in a general s...
monthly accountsaccounting entriesyear end accountsbalancejournal entries

Supply Chain Engineer
Future Solution Centre 7.00 to 12.00 Years Hyderabad,Ramgarh, Gopalganj, Oman, Kamrup, Noida, Chennai, United Arab Emirates, Kolkata, Rohtak, M 12 Nov, 2024

We are seeking a resourceful supply chain engineer to improve our supply chain operations. You will be analyzing supply chain procedures, recommending and implementing improvements, and determini...
communicationdatatimeanalysisassociate developmentproblemmanagementskills

Work From Home Freelancer Content Writer Data Entry
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Hyderabad,Nashik, Kochi, Chennai, Ernakulam, Kolkata, Pondicherry, Vishakhapatnam, Thrissur, Chandig 12 Nov, 2024

Dear Candidates, We are seeking an intern for a content writing position. This is an excellent opportunity for someone eager to gain hands-on experience and exposure to a dynamic company environ...
handwriting work from hometyping speed

Flexible / Part-time Remote Backed office executive
Pick Bright HR Solution 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Other Tamil Nadu, Thoothukudi, Kanpur, Thrissur, Mangalore, Neyveli, A 12 Nov, 2024

we are seeking a highly efficient data entry typist to join our team on a part time basis. Job Role: Fresher /Computer Operator/ Data Entry Operator / Back end office executive work. skills nee...
data entrytypingbackend

Data entry executive, Part time and full time work
VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 12 Nov, 2024

Dear candidate we have wonderful opportunity for home based jobs.Part time/ full time work. Laptop/Desktop Smartphone are required. Training will be provided by our team Desired skills and qu...
online work from homeonline part timework from homedata entry typinghome based data entrypart timeonline data entrydata entrydata entryin

Data Analyst , Senior Data Analyst , Data Analyst - Tech Lead
AppSoft Solutions 0.00 to 4.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 12 Nov, 2024

Data Analyst / Senior Data Analyst / Data Analyst - Tech Lead Very Urgent Requirement If Your Profile Matches The Above Requirement And If Youre Interested In The Above Openi...
data analyst

Territory Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Responsibilities

Devise effective territory sales and marketing strategies

Analyze data to find the most efficient sales methods

Meet with customers to add...
team managementsalescustomer relationshipbusiness developmentarea sales managementdistributionteam handlingmarketingchannel sales

Required Computer Typist ( part time work )
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Noida, Kolkata, Gurugram, Pune, Chandigarh, Mumbai City, Delhi 12 Nov, 2024

Better work culture with positive work environment. Interested candidates can apply now and send your respond to this post. Work Arrangement : Work From Home, Required candidates for part time...
offlinetypingonline data entryonlinedata entrywork from home typing

Process Analyst
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Hyderabad,Iran, Faridkot, Coimbatore, Zimbabwe, Mozambique, Jaipur, Iraq, Bangalore, Chennai, Kolkat 12 Nov, 2024

We are looking for a top process analyst to join our team. You will be meeting with clients to identify and discuss key business areas and processes that require improvement. Subsequent d...
process engineeringprocess excellencechemical analysischemical engineeringchemical researchprocess architectureprocess analysischemical testingprocess quality

Bio-tech Research Associate / Scientist
NEW ERA LIFE CARE PRIVATE LIMITED 2.00 to 7.00 Years Hyderabad,Iran, Zimbabwe, Mozambique, Jaipur, Bangalore, Iraq, Chennai, Noida, Kolkata, Lebanon, Gur 12 Nov, 2024

We are looking for a Biologist to join our team and conduct research and experiments to gain a better understanding about different biological organisms in nature. Biol...
sciencebiochemical engineeringresearch analysisbioprocessingmicrobiologybiochemistryneurostimulationmicrobiological analysisbiologics

SR.AWS Data Engineer
MAVINSYS GLOBAL PRIVATE LIMITED Hiring For Capgemini 6.00 to 8.00 Years Hyderabad 12 Nov, 2024

Hello,

Apache PySpark-Four to Six Years,

Data Engineer-Four to Six Years

pyspark,SQL,AWS

5 to 8 years

Hyderabad
dataawssqlapacheengineerpyspark

Freelance recruiter /Homebased
QRN Services 0.00 to 3.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Mumbai City, Delhi 12 Nov, 2024

NEED urgently freelancer recruiters, FRESHERS ELIGIBLE, Good communication skills in english and quick learner . Interested candidates dont apply online or send resumes contact: QRN Ser...
placementvacanciescustomer relationsfreelancecommunication skillsrecruitmenthiringhomebased

ACCOUNTANTS FRESHER IN DUBAI
WORK IN DUBAI TRAVELS 1.00 to 2.00 Years Hyderabad,Bhadrak, Bhubaneswar, Cuttack, Bangalore, Chennai, United Arab Emirates, Amritsar, Pune, L 12 Nov, 2024

e are looking for a reliable Management Accountant to assist senior management in making critical business decisions by analyzing and presenting key financial data. You will oversee accounting pr...
account managementaccounting

Required Part Time Home Based Computer Operator ( Typist )
VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Noida, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Patna 12 Nov, 2024

Dear candidate, We are offering a Permanent Job We are looking for freshers and experienced candidates for work from home urgently required candidates for data entry operators We are offering...
online work from homehome based data entrydata entry typingonline data entrydata entrypart timework from homeonline part timedata entryin

Chemical Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Design, develop, and optimize chemical processes to improve efficiency, safety, and cost-effectiveness.

Conduct process simulations and...
chemical analysischemical engineeringchemical researchchemical production

Accounts Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 7.00 to 12.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Financial Management: Oversee daily accounting operations, including accounts payable, accounts receivable, and general ledge...
tallyfinance executiveaccounts managerfinance accountsaccounts executiveaccountsaccountantaccounts assistant

Sales & Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Sales Strategy Development:

Develop and implement comprehensive sales strategies to drive revenue growth.
centrifugal pumpsservice marketingorder executionsales service

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Hyderabad,Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Korea, Kol 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Sales And Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City 12 Nov, 2024

Sales and Marketing Manager Responsibilities:

Promoting the companys existing brands and introducing new products to the market...
excelmarketing strategydata analysisbrand promotionmarket analysiswordmarketingconsumer behaviour

Technical Assistant
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City 12 Nov, 2024

Technical Assistant Responsibilities:

Answering telephones and taking messages.

Printing and filing documents.

Comp...
documentationproduct developmentproduct testingtroubleshootingtechnical assistant

Implementation Officer
KINAL GLOBAL CARE PRIVATE LIMITED 0.00 to 4.00 Years Hyderabad,Latur, Chakan, Singapore, Puerto Rico, Saudi Arabia, Panaji, Senegal, Bhubaneswar, Uganda, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Petroleum Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 17.00 to 25.00 Years Hyderabad,Bangalore, Chennai, Noida, Tirupati, Vijayawada, Kolkata, Gurugram, Mumbai City, Port Blai 12 Nov, 2024

We are looking for an experienced petroleum engineer to monitor oil and gas extraction and ensure all operations run smoothly. Youll design and schedule drilling activities both offshore and onsh...
engineeringpetreltechnicalproductionbusinesseclipsedevelopmentanalysissupportreportsariesreservoireconomic

Physical Asset Engineer
Klaus IT Solutions Private Limited 1.00 to 3.00 Years Hyderabad,Bangalore, Chennai, Coimbatore 12 Nov, 2024

Physical Asset Verification Exp: - 1 - 3 yrs Shift timings: - 9AM - 6PM Working days: - 5 Days Location: - Bangalore, Coimbatore, Pune, Hyderabad 1-2 years of experience in physical asset verif...
physical verificationcommunication skillsexcelphysical asset managementsapreportingasset verification

Immediate Vacancies for Electrical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Hyderabad,Bangalore, Kochi, Chennai 12 Nov, 2024

Job Description Electrical Engineer Educational Qualification: BE / B.Tech in Electrical Job Types : Fresher, Experienced Salary : Rs.25,000/- to 50000/- Responsibilities: Designing, maintain...
transformerselectrical designelectrical maintenanceswitchgearautomation

Senior Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Hr Service Associate
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 1.00 to 5.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Chemical Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Ghaziabad, Gurugram, Faridabad, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Process Design and Optimization: Design, develop, and optimize chemical manufacturing processes, ensuring efficiency, co...
chemical researchchemical engineeringchemical analysis

Hr Advisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Provide professional HR advice and support to managers and employees on a variety of HR topics, including employee relations, performance managem...
recruitmentscreeningshortlistinginterview schedulingsourcing profilesinterview coordination

Store Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 12 Nov, 2024

Key Responsibilities:

Lead and manage the day-to-day operations of the store, including sales, customer service, inventory management, and merchandising.

Dev...
inventory controlstore operationsstore planningsales strategycustomer servicestores maintenancestore keeping

Sales Support Backend Ops.
Topgear Consultants Private Limited 0.00 to 3.00 Years Hyderabad 12 Nov, 2024

Handling customer/distributors queries/complaints over email/phone.

Handling Contest related work Includes co-ordination with external vendors for ticketing & booking
operationsassetsupportmanagementvendoramcsalesfunds

Sales Manager
ICICI HOME FINANCE COMPANY LTD 1.00 to 6.00 Years Hyderabad 12 Nov, 2024

communication skillsfield sales

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Kore 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Petroleum Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 17.00 to 25.00 Years Gurugram,Noida, Bangalore, Chennai, Tirupati, Vijayawada, Hyderabad, Kolkata, Mumbai City, Port Blai 12 Nov, 2024

We are looking for an experienced petroleum engineer to monitor oil and gas extraction and ensure all operations run smoothly. Youll design and schedule drilling activities both offshore and onsh...
engineeringpetreltechnicalproductionbusinesseclipsedevelopmentanalysissupportreportsariesreservoireconomic

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Kore 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Director Of Operations
TRAAB ENGINEERING INDIA PRIVATE LIMITED 14.00 to 24.00 Years Delhi,Ambala, Bangalore, Bhagalpur, Chennai, Hyderabad, Kolkata, Mumbai City, Panaji, Ahmedabad 12 Nov, 2024

We are looking for an experienced Director of Operations to organize and oversee the daily operations of our company. You will be the one to ensure that our business is well-coor...
logisticscustomerservicepayrolloversightreportsprocessmanagementhumanprojectresourcesdirectimprovementpatients

Project Coordinator
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 12 Nov, 2024

Understand a projects scope and create documents for project requirements

Conduct project meetings to communicate individual roles, project expectations, a...
project managementsmart plant reviewcaesar iiautocadpiping engineeringpdms

JDE-SND(Sales and Distribution)
LTIMindtree Limited 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 12 Nov, 2024

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Kore 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Implementation Executive
KINAL GLOBAL CARE PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Faridabad, Singapore, Surat, Puerto Rico, Saudi Arabia, Senegal, Uganda, Peru, Rajahmundry, 12 Nov, 2024

ob responsibilities: Design all job requirements and specifications and manage all communication with implementation analysts. Resolve all issues and develop all programs according to client ...
project managementimplementation planningimplementation experiencebusiness developmentsoftware installationorder managementstatistical modelingdata analysisproduct training

Petroleum Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 17.00 to 25.00 Years Gurugram,Noida, Bangalore, Chennai, Tirupati, Vijayawada, Hyderabad, Kolkata, Mumbai City, Port Blai 12 Nov, 2024

We are looking for an experienced petroleum engineer to monitor oil and gas extraction and ensure all operations run smoothly. Youll design and schedule drilling activities both offshore and onsh...
engineeringpetreltechnicalproductionbusinesseclipsedevelopmentanalysissupportreportsariesreservoireconomic

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Kore 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Data entry executive, Part time and full time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Patna 12 Nov, 2024

Dear candidate we have wonderful opportunity for home based jobs.Part time/ full time work. Laptop/Desktop Smartphone are required. Training will be provided by our team Desired skills and qu...
online work from homeonline part timework from homedata entry typinghome based data entrypart timeonline data entrydata entrydata entryin

Category Manager
CP CONSULTANCY SERVICES 8.00 to 13.00 Years Gurugram 12 Nov, 2024

Job Responsibilities: 1. To plan a new product launch pan India. 2. To handle category management and business P&&L 3. To set up the Central Sourcing strategy local / PAN India. 4. To negotiate ...
pulsericevendor managementsourcingcategory managementproduct managementcategory

Head Logistics
FRONTLINE TECH JOB CONSULTANTS 15.00 to 25.00 Years Gurugram,Noida, Bangalore, Hyderabad, Pune 12 Nov, 2024

Job description Responsibilities:

Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution.
material managementlogistics managementwarehouse operations

Data Scientist
MAVINSYS GLOBAL PRIVATE LIMITED 6.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 12 Nov, 2024

Statistical Analysis & Data Modeling: Use advanced statistical techniques such as forecasting, time series analysis, trend an...
data modelingforecasting skills

Sales & Marketing Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 13.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 12 Nov, 2024

Key Responsibilities:

Sales Strategy Development:

Develop and implement comprehensive sales strategies to drive revenue growth.
centrifugal pumpsservice marketingorder executionsales service

Guest Relations Manager
AES INDUSTRIAL PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Bosnia And Herzegovina, Panaji, Senegal, South Korea, Bangalore, Chennai, North Kore 12 Nov, 2024

Guest Relations Manager responsibilities include greeting clients as they arrive, coordinating their check-ins to assigned rooms and informing them about the hotels facilities. You will also make...
visitor managementguest satisfactioncafeteria managementguest handlingguest serviceperimeter protectiondata entryguest houseguest house management

Institutional Sales Manager
Batra Henlay Cables 5.00 to 10.00 Years Delhi 12 Nov, 2024

Job Title: Institutional Sales and Marketing Manager We are seeking an experienced and results-driven Institutional Sales and Marketing Manager to join our team...
business developmentproject sales

PREV
NEXT

data updation Job Openings

Responsibilities Devise effective territory sales and marketing strategies Analyze data to find the most efficient sales methods Meet with customers to add... team managementsalescustomer relationshipbusiness developmentarea sales managementdistributionteam handlingmarketingchannel sales

Sales and Marketing Manager Responsibilities:

Technical Assistant Responsibilities:

Job description The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business... financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Job description Good organizational and prioritisation skills Analytical and problem-solving skills Multi-cultural awareness Passion for customer servi... process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Key Responsibilities:

Job description Responsibilities: Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution. material managementlogistics managementwarehouse operations

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities

Devise effective territory sales and marketing strategies

Analyze data to find the most efficient sales methods

Meet with customers to add...
team managementsalescustomer relationshipbusiness developmentarea sales managementdistributionteam handlingmarketingchannel sales

Job description

The Product Development (PD) team within Morgan Stanley Fund Services (MSFS) is the change & transformation think tank that works with the fund services business...
financial reportingtest casesoperationsbusiness strategydata structuresvisioautomationcoding

Job description

Good organizational and prioritisation skills

Analytical and problem-solving skills

Multi-cultural awareness

Passion for customer servi...
process documentationservice deliverycustomer serviceprocess improvementpresentation skillssuccessfactors

Job description Responsibilities:

Manage end to end supply chain processes which includes inventory management, warehousing, logistics and distribution.
material managementlogistics managementwarehouse operations