employee safety jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

employee safety Job Openings

Showing 27401 - 27450 of 28371 Jobs

Store manager Mysore

KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Mysore 23 Sep, 2023

delivery managementstore operationsstore keepingstore supervisionstore management

Electrical Engineer-Mysore

JS Placement Services 0.00 to 3.00 Years Mysore 23 Sep, 2023

electrical engineeringtroubleshooting

Urgent hiring for CIVIL SITE ENGINEER in Dubai

Always International Manpower Service Hiring For Civil /Site engg/Mechanical /Electrical Engineer Supervisor 1.00 to 6.00 Years Mangalore 23 Sep, 2023

Civil Site Engineer Civil Foreman / Mechanical Engineer / Electrical Engineer Job in Dubai

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ...
mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Hiring For Civil Engineer
Kavya Staffing Solutions 0.00 to 4.00 Years Mangalore 23 Sep, 2023

We are looking for an experienced, driven civil engineer with a wealth of industry knowledge. To ensure success, the ideal candidate should be comfortable splitting their hours between the office...
managementplanningconstructionautocadproject

Area Talent Management Executive
Jio Platforms Limited 2.00 to 6.00 Years Kochi 23 Sep, 2023

Job Title: Area Talent Management Executive Industry: Telecom Functional Area: Jio Human Resources No. of vacancies: 5 Experience: 02 to 06 Years Annual CTC: 06 to 08 LPA Qualification: Mas...
employee engagementpmstalent managementtalent acquisitionrecruitment managementhr operationsinduction trainingrecruit-from-rosterijp

Voice Process (International)
Intouch CX 0.00 to 4.00 Years Hyderabad 23 Sep, 2023

We are hiring for International Voice Process only for immediate joiner (Customer support) Experience: 6 months - 4 years Salary - ...
voice processinternational bpo

Hr Generalist
AVELI RETAIL AND TRADE SERVICES PRIVATE LIMITED 2.00 to 3.00 Years Hyderabad 23 Sep, 2023

What youll do Job description: As an Hr Generalist at Aveli group, you will play a pivotal role in our HR operations, managing end to end recruitment, onboarding, performance management, payrol...
recruitmentonboardinghr operationsemail writinghr administration

Looking for CDP Asian - Authentic Asian Background
Hyatt 1.00 to 4.00 Years Hyderabad 23 Sep, 2023

You will be responsible to assist with the efficient running of the department in line with Hyatt Internationals Corporate Strategies and brand standards, whilst meeting employee, guest and owner...
microsoft outlookpowerpointmicrosoft excelmicrosoft word

Team Leader - Laundry
Hyatt 2.00 to 4.00 Years Gurugram 23 Sep, 2023

* You will be responsible for the efficient running of the department in line with Hyatt Internationals Corporate Strategies and brand standards, whilst meeting employee, guest and owner expectati...
salescustomer relationsslaqualitycoachingrooms divisionproblem solvinginterpersonal skillsbrandtourismlaundryrunninghospitalityadministrationRooms Division ManagementOpening HotelsLodgingOnQProperty Management Systems

Hire Engineer-Faridabad
JS Placement Services 0.00 to 3.00 Years Faridabad 23 Sep, 2023

designtroubleshooting

Hire Engineer-Noida
JS Placement Services 0.00 to 3.00 Years Noida 23 Sep, 2023

designtroubleshooting

Electrical Engineer-Faridabad
JS Placement Services 0.00 to 3.00 Years Faridabad 23 Sep, 2023

electrical engineeringelectrical systems

Electrical Engineer-Noida
JS Placement Services 0.00 to 3.00 Years Noida 23 Sep, 2023

electrical engineeringtroubleshooting

Manufacturing Quality Line In-charge Battery Testing
Hero MotoCorp Ltd 5.00 to 7.00 Years Delhi 23 Sep, 2023

Function Quality Pay Band E4 to M2 Role As the Manufacturing Quality Line In-charge Battery Testing you ...
sporting goods industrycontinuous improvement facilitationfield hockeylatin americamass productionapplicationscritical thinkingelectric vehiclesdurability testingquality improvementmanufacturing qualityimprovement activitieseffective communica

INSIDE SALES REPRESENTATIVE-Chennai
Employee HR Services 0.00 to 3.00 Years Chennai 23 Sep, 2023

Requirements and skills

Proven inside sales experience

Track record of over-achieving quota

Strong phone presence and experience dialing dozens of calls per day<...
crminside salescalling

Multi Technician UAE 9th Sep.
GLOBAL WINGZ CAREERS Hiring For Multi Technician_UAE 9th Sep 4.00 to 7.00 Years Chennai 23 Sep, 2023

Dear Applicants, Greetings from Global Wingz Careers LLP!! We are looking for applicants willing to work for UAE Mode of Interview:Direct Client Interview Da...
plumbingelectricalsmulti technician

Assistant F&B Manager
Westin Hotel 1.00 to 3.00 Years Chennai 23 Sep, 2023

Job Number hidden_mobile4 Job Category Food and Beverage & Culinary Location The Westin Chennai Velachery, 154 Velachery Main Road, Chen...
budgetingforecastingsalesbalanceconsultingcustomer serviceequipment supplyservice managementbehavioral trainingcorporate accountingrestaurant managementemployee satisfactioncontinuous improvementbusiness administrationfinancial justification

Team Leader - Banquets
Hyatt 2.00 to 4.00 Years Chennai 23 Sep, 2023

*

You will be responsible to assist with the efficient running of the department in line with Hyatt Internationals Corporate Strategies and brand standards, whilst meeting employee, guest ...
salescustomer relationsslaqualitycoachingproblem solvinginterpersonal skillshotelbrandtourismrunninghospitalityadministrationProblem AnalysisOperation MonitoringPlanningProblem SensitivitySocial PerceptivenessTeam Problem Solving

FM Specialist
Nokia Solutions and Networks India Pvt Ltd 2.00 to 10.00 Years Chennai 23 Sep, 2023

Come create the technology that helps the world act together Nokia is committed to innovation and technology leadership across mobile, fixed and cloud networks. Your career here will ha...
root cause analysisnode blife cycleroot causefault managementservice providersfault rectificationnetwork performancetechnology leadership

Chemist Quality Control
FAST FREEDOM LIFE PRIVATE LIMITED 3.00 to 8.00 Years Ahmedabad 23 Sep, 2023

Theyperform routine daily testing and inspections of lab equipment and materials. They ensure compliance with all applicable federal standards and regulations, along with adheren...
qc toolschemist validationraw materialanalytical testinganalytical chemistryproductionpackagingquality controlanalytical

Hiring Office Administrator for a Leading Pharma Industry - Ahmedabad Location
POST A RESUME 1.00 to 3.00 Years Ahmedabad 23 Sep, 2023

Job Overview: We are seeking a highly organized and detail-oriented Office Administrator to ensure the smooth day-to-day operations of our office. The ideal candidate will be a ...
administration managementgeneral administration

Hiring for Accountant, Back Office Executive and Computer Operator
Recruitment India 0.00 to 2.00 Years Ahmedabad 23 Sep, 2023

Accounting Assistant Roles & Responsibilities

Process payments and documents such as invoices, employee reimbursements, and financial statements
back officeaccountingback office operations

Urgent | Hiring Hr Executive (Female) in Ahmedabad Location
POST A RESUME 2.00 to 7.00 Years Ahmedabad 23 Sep, 2023

Dear Candidate, Greetings from POST A RESUME HR Consultancy, We would like to take this opportunity to introduce ourselves, POST A RESUME HR Consultancy as a leading Human Resource Management...
hr generalist activitieshr assistancepayroll processing

Senior Accountant
IGNIS INFRA-TECH SOLUTIONS PRIVATE LIMITED 3.00 to 6.00 Years Mumbai City 22 Sep, 2023

Dear Candidate Greetings from Fairpick! Job Title: Senior Accountant Key Responsibilities: Financial Reporting and Analysis: Prepare and analyze financial statements, including balance sheets...
gsttds

apply now Vehicle Computer- Functional Safety Engineer
Bosch Group 3.00 to 5.00 Years Bangalore 22 Sep, 2023

Job Description Mandatory skills:

Very Good understanding of ISO 26262 safety dev process

Hand-on experience of working on Microprocessor domain

Good ...
safetyfirst aidinspectionsiterisk assessmentsoftware engineeringprogramming languagestechnical documentationautomotive locksmithingagile scrum

Store Manager
NATIONAL SEEDS CORPORATION LIMITED 5.00 to 10.00 Years Bangalore 22 Sep, 2023

We are looking for a professional and customer service-oriented store manager to oversee daily operations at our store. As the store manager, you will supervise the operational and organizational...
business strategiesstore keepingsupervisionhr operationsmonitoringstores maintenancesafety trainingsales support

Pharmacovigilance Officer
QUISCON BIOTECH 0.00 to 1.00 Years Bangalore 22 Sep, 2023

Pharmacovigilance Associate- Freshers Typical responsibilities include: recording and reporting adverse reactions received from healthcare professionals and consumers conducting in-depth interv...
clinical research associatesclinical pharmacologyclinical trialsclinical monitoringclinical data management

Team Assemblers
Krishna Consultancy Hiring For Schneider Electric 10.00 to 20.00 Years Bangalore 22 Sep, 2023

Assemblers are a vital part of the manufacturing process and can be found in almost any field. Their job titles may vary according to the industry, but some commonly used titles for assemblers ar...
organizationdexterityphysical fitnessresource conservationdetail orientation

Technical Lead Associate
Cognizant 2.00 to 0.00 Years Bangalore 22 Sep, 2023

Technical Lead Qualification: Bachelors in science , engineering or equivalent Responsibility: Requirement Understanding and Analys...
test datatest management tooltest cases

We Have Reuire Application Developer
Accenture 1.00 to 6.00 Years Bangalore 22 Sep, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
kaizenlean manufacturingsafetyinspectionmachiningms sql serverms sqlvisual studiobusiness processsystem installationsoftware engineeringsystem administrationprofessional servicessqlapi

Branch Manager
AV Global Advisory Services 10.00 to 15.00 Years Vishakhapatnam 14 Sep, 2023

Urgent Vacancy with Leading Bank Role- Branch Manager - Retail Banking Location: Guntur, Vijayawada, branch manager

Process Engineer
AVHAD ENTERPRISES 5.00 to 10.00 Years Vishakhapatnam 14 Sep, 2023

We are looking to hire a skilled process engineer to oversee the design and implementation of our company processes. As a process engineer, you will be responsible for developing and implementing...
designproject engineeringprocessoilfront end engineering designconstructionengineering change controlengineering consultancyengineering change managementgasengineering servicesmechanical engineeringengineering

We Need EHS Executive
Foursis Technical Solution 5.00 to 7.00 Years Vadodara 14 Sep, 2023

Job functions area : Safety / Fire / Guards / Security Location : Vadodara Experience : 5 - 7 years Skills : AUDIT, HAN...
safetyrisk assessmentehsinspection

Apply for HR executive - Vadodara
Foursis Technical Solution 2.00 to 4.00 Years Vadodara 14 Sep, 2023

Job functions area : Human resources - HR / Company Relationships / Recruiter Location : Vadodara Experience : 2 - 4 years Skills...
recruitmentrecruitinghuman resourcesinductionjoining formalitiespayrollstaffingOnboardingHR Policies

Head Engineering - Vadodara
Foursis Technical Solution 8.00 to 11.00 Years Vadodara 14 Sep, 2023

Job functions area : Engineering / Manufacturing / Production / Maintenance Location : Vadodara Experience : 8 - 11 years Skills ...
mechanicalmachinerycivilsafetysapquality checkmonitoringmaintenanceengineeringdocumentationKaizenRoot Cause AnalysisSix Sigma

Apply for HR Manager - Vadodara
Foursis Technical Solution 2.00 to 5.00 Years Vadodara 14 Sep, 2023

Job functions area : Human resources - HR / Company Relationships / Recruiter Location : Vadodara Experience : 2 - 5 years Skills...
recruitmenthuman resourcesrecruitinginductionpayrollstaffingHR PoliciesWorkforce Planning

Aircraft Maintenance Engineer Recruitment
Kavya Staffing Solutions 0.00 to 4.00 Years Vadodara 14 Sep, 2023

We are looking for an experienced Aircraft Maintenance Engineer to join our team and ensure the safety of our aircraft. The aircraft maintenance engineers responsibilities include conducting insp...
technician activitiesaeronauticalaerospace designaircraft

HEAD OF OIL AND GAS
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Vadodara 14 Sep, 2023

Location-Chennai / Vadodra Experience -3 - 5 Years Industry - ITES/IT/International BPO/KPO Budget - 6 - 6.5 LPA W...
retentiongrievance handlinggrievancesemployee engagement

Director Engineering for Oil &Gas .
MNR Solutions Pvt Ltd 15.00 to 23.00 Years Vadodara 14 Sep, 2023

Hiring for Director Engineering for Oil &Gas . Location Chennai/Vadodara Experience 15 to 25 years.

Required experience of Solution selling for entire for APAC Re...
employee engagementgrievance handlinggrievancesretention

Branch Operation Manager Branch Banking
Talentera Consultancy Hiring For PVT BANK 1.00 to 3.00 Years Pune 14 Sep, 2023

JOB DESCRIPTION:- Train all service managers for everyday maintenance operations for various assign branches and recommend improvements to increase efficiency and meet a...
savings accountsfixed depositsoperations managementbranch managementbranch operationbranch handlingback officebanking operations

Carpenter Foreman
AWINMO INDIA MARKETING PRIVATE LIMITED 8.00 to 13.00 Years Pune 14 Sep, 2023

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical

Territory Manager _PUNe
Lavya Associates HR Services 6.00 to 10.00 Years Pune 14 Sep, 2023

We have urgent openings for the position ofTerritoryManager with most of the leading life Insurance Companies in Banca Vertical. bfsilife insuranceinsurancebusinesssalesbranch handlingbanking

Farm Manager
RAMA TECHNICAL CONSULTANTS 11.00 to 21.00 Years Pune 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm managementfarmingfarm equipmentagricultural machinery

Farm Supervisor
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Pune 14 Sep, 2023

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
agriculture bankingfarmingagriculture marketingplant protection

Construction Manager
RAMA TECHNICAL CONSULTANTS 10.00 to 20.00 Years Pune 14 Sep, 2023

We are looking for an enthusiastic, organized construction manager to oversee all aspects of our building project, including meeting with project partners, managing supervisors, and teams. The co...
contract managementcontract manufacturingconstruction management

We have requirement for Service Operation Specialist IMS
Nokia Solutions and Networks India Pvt Ltd 7.00 to 12.00 Years Pune 14 Sep, 2023

Join us in creating the technology that helps the world act together We are a B2B technology innovation leader pioneering the future where networks meet cloud. At Nokia you...
technical supportcore networkpreventive maintenancesystem integration

Area Manager _PUNE
Lavya Associates HR Services 6.00 to 10.00 Years Pune 14 Sep, 2023

We have urgent openings for the position ofBranchManager with most of the leading life Insurance Companies in Banca Vertical. branch handlingsaleslife insurancebankingbfsiinsurance

Guest Services Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 7.00 Years Pune 14 Sep, 2023

As a guest service manager, you will ensure a smooth check-in and check-out process and ensure that all payments are made. You will manage all lobby activities and see to the functionality of hot...
teamworkcommunication skillsinterpersonal skillsteam management skills

Area Manager _NAGPUR
Lavya Associates HR Services 6.00 to 10.00 Years Nagpur 14 Sep, 2023

We have urgent openings for the position ofBranchManager with most of the leading life Insurance Companies in Banca Vertical. branch handlingsaleslife insurancebankingbfsiinsurance

Store manager Nagpur
KABIR CONSULTANCY Hiring For - 0.00 to 1.00 Years Nagpur 14 Sep, 2023

Store Manager Responsibilities:
store keepingstore managementstores maintenancestore supervisiondelivery management

PREV
NEXT

employee safety Job Openings

Civil Site Engineer Civil Foreman / Mechanical Engineer / Electrical Engineer Job in Dubai

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ... mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Requirements and skills Proven inside sales experience Track record of over-achieving quota Strong phone presence and experience dialing dozens of calls per day<... crminside salescalling

Accounting Assistant Roles & Responsibilities

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f... mechanicalskills.dexterity.mathproblem-solving.strength.physical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Salary : 1800 to 5500 AED . ( INR 35000 to 1 lakh- PM) Facilities : Accommodation ...
mechanical designmechanical engineeringpower distributionelectrical engineeringcivil constructionmechanical electrical plumbingcivil site engineeringcivil infrastructure

Requirements and skills

Proven inside sales experience

Track record of over-achieving quota

Strong phone presence and experience dialing dozens of calls per day<...
crminside salescalling

Carpenter Job Description Template We are looking to hire a skilled carpenter with knowledge of various carpentry techniques. You will be responsible f...
mechanicalskills.dexterity.mathproblem-solving.strength.physical