executive maintenance jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

executive maintenance Job Openings

Showing 16901 - 16950 of 49487 Jobs

Online Work From Home, Data Entry Typing , Computer Operator Typist Part Time

Ruppan India Nidhi Limited 0.00 to 1.00 Years Indore,Bhubaneswar, Jaipur, Navi Mumbai, Thane, Chandigarh, Surat, Coimbatore, Ahmedabad, Guwahati 01 Apr, 2025

Positi...
online work from homedata entry typinghome based data entrydata entryonline data entry

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Hyderabad,Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chennai, Noida, U 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Part - Time Work From Home - Need Handwriting Executive ( Writer )
VISHWANATH ENTERPRISES 0.00 to 1.00 Years Hyderabad,Bhubaneswar, Jaipur, Madurai, Chennai, Kolkata, Pondicherry, Pune, Mumbai City, Coimbatore 01 Apr, 2025

Need - Data Entry Specialist We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. We are offering a Permanent Job urgently required...
writing skillstyping speedhandwriting work from home

Need Freelancer - Data Entry Operator - Work At Home, Apply Now
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Hyderabad,Ernakulam, Chennai, Vishakhapatnam, Kolkata, Pune, Chandigarh, Thrissur, Hubli, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home We are offering a Job Part Time Jobs Data Entry Work Online Computer Work Work From Home Back Office Ex...
typing speeddata entrywriting skillspart time

Urgent Hiring For Data Entry executive Profile
Aspect Solution 0.00 to 1.00 Years Hyderabad,Tiruchengode, Mohali, Vizianagaram, Salem, Kolkata, Vilupuram, Mumbai City, Mysore, Ahmeda 01 Apr, 2025

Wehave urgent need of Data EntryTyping job, who is dedicated and serious about his/her work. Position: Fresher /Computer Operator/ Data Entry Operator skills needed: basic computer knowledge ....
data entrytypingexcel

Online Back Office Executive, Data Entry coordinator work
Pick Bright HR Solution 0.00 to 1.00 Years Hyderabad,Dehradun, Chennai, Ernakulam, Idukki, Vijayawada, Bhuj, Chandigarh, Ranchi, Mysore 01 Apr, 2025

Dear applicant, Online data entry jobs is normal typing work. Just require typing speed 30 to 50 wpm. Our company hiring every month fresher for daily online jobs Employment Type: english writingtypingdata entry

Backed office executive, anyone can apply
Aspect Solution 0.00 to 1.00 Years Hyderabad,Gulbarga, Other Telangana, Bangalore, Dehradun, Other Tamil Nadu, Nellore, Agartala, Other 01 Apr, 2025

Dear candidate, Dive into the world of online part-time jobs, where you canwork without compromising your studies! Job Position: Computer Operator, Data entry operator, Back office,Part time Jo...
excelback officedata entry

Data Entry Clerk
APEX TRADING & SOFTECH SOLUTIONS Hiring For APEX TRADING SOFTECH SOLUTIONS 0.00 to 1.00 Years Hyderabad,Indore, Noida, Lucknow, Gurugram, Pune, Mumbai City, Delhi, Vadodara, Bhopal 01 Apr, 2025

Dear candidate, We are looking for freshers and experienced candidates for work from home One of the best opportunity for part time job seekers, it is good opportunity for those, who wants to w...
data entrydata entry operationback office operationscomputer operatingdata entry work from home

Hr Executive
H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Greeting from H I R E! Hiring for the following Job Vacancy :HR Executive Key Responsibilities 1. Provide support for recruitment efforts, including job postings, interviewing, and onboarding....
interview schedulingemployee engagementonboardingpostingrecruitment

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Mechanical Engineer
C Balaji Hiring For rudra 0.00 to 1.00 Years Hyderabad,Bangalore 01 Apr, 2025

Job description: We are seeking a passionate Trainee - Mechanical Engineer Fresher. Role - Graduate Engineer Trainer Experience - 0 to 6 Months Job Location - Hyderabad B. Tech ...
mechanical maintenancemechanical engineering

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Maintenance Technician
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Ethiopia, Bangladesh, Bangalore, Chennai, Noida, Vizianagaram, Kolkata, Gurugram, Pune, Mu 01 Apr, 2025

We are looking for a thorough Maintenance Technician to undertake the responsibility to preserve the good condition and functionality of premises. You will perform maintenance ta...
hvacelectrical systemsindustrial maintenanceplumbingperform routine maintenancemaintenance techmechanical equipmentsafety standardsmaintenance tasks

Business Development Executive
CONSULTBAE INDIA PRIVATE LIMITED 2.00 to 5.00 Years Hyderabad 01 Apr, 2025

Role:Business Development Executive Exp Required:2 years Location:Hyderabad Industry Radio, TV, Media / Advertisement salesradiob2b salesretail sales

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Online Data Entry Operator, Data Entry Clerk, Data Entry Typing, Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

Freshers and Experienced both can apply for this jobs. Position- Data Entry Executive, Computer Operator, Typist. Back Office Executive Location: Work From Hom...
online work from homedata entry typingonline data entrywork from homepart timedata entry

Part Time Computer , Back Office Executive, Typist, Typing, Online Data Entry
Ruppan India Nidhi Limited 0.00 to 1.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi, Patna 01 Apr, 2025

We are offering a Job. Data Entry Operator, Computer Operator, Back Office Executive, Typist Freshers and Experienced both can apply for this jobs. Position- Data Entry Executi...
part timeback officeonline work from homedata entry typinghome based data entrywork from homedata entryonline data entrydata entryin

Customer Care Executive
Conneqt Business Solutions Limited 0.00 to 2.00 Years Hyderabad 01 Apr, 2025

Process: Axis Bank Inbound Voice (Customer Support) Qualification: Intermediate & Above Salary: Freshers: 14000 TH (NAPS) Languages: English & Hindi 6 Days Working 1 rotati...
communication skillsflexible

Part Time , Data Entry , Online Typing , Home Based , Work From Home
Ruppan India Nidhi Limited 0.00 to 1.00 Years Gwalior,Jabalpur, Kurnool, Jodhpur, Vapi, Kota, Vijayawada, Thrissur, Ambala, Cuddalore 01 Apr, 2025

We are offering a Job. Part Time Jobs, Data Entry Work, Online Computer Work, Work From Home, Back Office Executive, Typist, Online Typing Jobs Freshers and Experienced both can apply for this j...
data entry typingpart timework from homeback officeonline data entrydata entrycontent writingcomputer operatingonline work from home

Exciting Data Entry Executive Role Work from Home Opportunity
Pick Bright HR Solution 0.00 to 1.00 Years Gwalior,Bangalore, Chennai, Bidar, Udupi, Thane, Thrissur, Yavatmal, Surat, Chatra 01 Apr, 2025

Dear candidate, We are excited to announce immediate openings for Part-Time Data Entry Operator roles with our company, available for candidates across India. skills needed: basic computer know...
english writingdata entry

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Ernakulam, Kochi, Bokaro, Malappuram, Kozhikode, Thrissur, Ranchi 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Urgent Hiring for Field sales executive for Hyderabad, Prayagraj , Visakhap
Jobs Territory 1.00 to 4.00 Years Gwalior,Ongole, Tirupati, Hyderabad, Other Andhra Pradesh, Vijayawada, Vishakhapatnam 01 Apr, 2025

Sr. Solar Sales Specialist Roles and responsibilities: Responsible for meeting Monthly Sales targets of Solar PV systems for Residential clients. Lead Generation - Ensure that all marketing le...
solar energysalesfield sales

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Warehouse Supervisor
SHARMA ENTERPRISES 1.00 to 6.00 Years Gwalior,Indore, Bhopal, Bishnupur, Imphal, Shillong, Imphal West, Senapati, Churachandpur, Thoubal 01 Apr, 2025

We are looking for an experienced warehouse supervisor to manage and oversee all warehouse activities, ensure efficient processes, and maximize warehouse productivity. The warehouse supervisors r...
performancesupervisioninventorysafetymonitoringleadership

Housekeeping Executive
PVR INOX LIMITED 1.00 to 6.00 Years Gwalior,Bhopal 01 Apr, 2025

PVR INOX Ltd. Is Hiring! Designation :- Housekeeping Executive Locations :- PVR INOXBHOPAL (Aura Mall) and PVR INOX GWALIOR (DB MALL) Qualifications: Graduate/ Post- Graduate Certificate cours...
housekeepinghousekeeping management

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Tele Sales Executive
XIPHI INSIGHTS PRIVATE LIMITED 1.00 to 2.00 Years Gurugram 01 Apr, 2025

A Real Estate Telesales job description typically involvesgenerating leads, making outbound calls to potential clients, presenting properties, and closing sales deals, all whi...
communication skillscallinginternational

Hr Manager
Wingexcel services 4.00 to 9.00 Years Gurugram,Delhi 01 Apr, 2025

Urgent Hiring For Sr. HR Executive Or Assistant Manager HR Company Profile - Manufactring Salary - Upto 35kpm Or Negotiable for deserving Candidate Salary - Upto 35kpm Or Negotiable Experience - ...
hr administrationhr generalist activities

Pipeline Engineer
Garima Interprises 1.00 to 6.00 Years Gurugram,Delhi, Noida, Australia, Austria, Canada, Other AndamanNicobar, Port Blair, Bangalore, Chen 01 Apr, 2025

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Field Sales Executive
TRAVELMAGNET INFOTECH PRIVATE LIMITED 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

About the Role: We are looking for energetic and customer-focused Field Sales Executives to drive merchant acquisition and promote digital payment solutions, specifically EDC (c...
field salessales

Opening for Freelance Recruiter with Talentsphere Management Services
Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Greetings from Talentsphere Management Services! I hope youre doing well. We are excited to introduce a fantastic opportunity for you to collaborate with us a...
screening resumesexecutive searchfreelance recruitmentrecruitmentnon it recruitmenttechnical recruitingit recruitment

Telecaller
THE TALENT KEEPERS 2.00 to 7.00 Years Gurugram 01 Apr, 2025

URGENT HIRING ! Profile-Telecaller Executive Company- Real Estate Location- Gurugram ROLES & RESPONSIBILITIES
customer careinbound processbpotelecallingcalling

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Urgent hiring for site supervisor
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Meerut 01 Apr, 2025

Urgent hiring for Project Executive or Site Supervisor Job Location:- gurgaon, delhi, noida jaipur .kolkata ,meerut Salary:- Up to 22k ESI/PF TA Incentive
design managementproject coordinationproject management

Mechanical Supervisor
Xperts Manpower Solutions Enterprises Hiring For Japanese MNC Fresher Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

We have an urgent requirement of Be Mechanical candidates for production and quality profile in automobile industries for manufacturing units candidates should be the fresher which will be haired...
machine shopmachine assemblyquality engineeringmechanical maintenancemechanical engineeringassembly shopprocess inspectionproduction engineering

Mechanical Engineer Fresher
Sanskar HR Consultancy Services Hiring For Manufacturing Industry 0.00 to 1.00 Years Gurugram,Noida 01 Apr, 2025

Urgent Hiring for B.tech/Diploma Mechanical Engineer Job Description Total Vacancies: - 60 Dear Candidates Your Resume Is Shortlisted for Automobile & Manufa...
qualitydiplomamechanicalproductionmaintenance

Data Entry Executive Work For Freshers,Part time work
VRD INFOTECH 0.00 to 1.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Bhopal 01 Apr, 2025

Dear Job applicant, It is one of the easiest part-time online jobs for candidates Position: Fresher /Computer Operator/ Data Entry Operator / backed office executive skills needed: basic compu...
exceltypingdata entry

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hiring for Field Sales Executive in Delhi NCR
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description Job Title: Sales Consultant Location: Delhi NCR Salary: 25000 CTC (Including Petrol allowance of 2000) Experience: 0-1 year Qualification : Graduate ...
salesfield salessales executive activities

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Automotive Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Guwahati 01 Apr, 2025

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Cnc Machinist
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Faridabad, Ambala, Hyderabad, Dhubri, Chandigarh, Bhillai, Silvassa, Guwahati 01 Apr, 2025

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

PREV
NEXT

executive maintenance Job Openings

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job Description / Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline... budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia... constructionautomobile engineeringautomobileconstruction managementengineering management

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i... cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Pipeline Engineer Job Description Template We are looking for a highly experienced pipeline engineer to design and develop a variety of pipeline...
budgetingblueprintcommunicationrepairconstruction technologytechnical standards

Job brief We are looking for a skilledAuto Mechanicto maintain and repair vehicles. You will be responsible for troubleshooting issues and fixing them aiming to maximum relia...
constructionautomobile engineeringautomobileconstruction managementengineering management

Job brief We are looking for a competentCNC Operatorto use computer numerically controlled (CNC) machinery safely and accurately to perform a variety of functions. Your job i...
cnc maintenanceconstructionengineeringconstruction engineeringconstruction equipmentcnc programmingcnccnc manufacturing