financial advisory services jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

financial advisory services Job Openings

Showing 27201 - 27250 of 76057 Jobs

Sr HRBP Associate -Gurugram

MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

hr operations

hrbp

associate

Hiring for Field Sales Executive in Delhi NCR

AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description

sales

field sales

sales executive activities

Tele Caller

Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title:

Location:

Experience:

bpo

lead generation

customer relationship

Lead Generation Expert

Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title:

Location:

Job Summary:

voice process

international call center

Equity Dealer

Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate,

Greetings From APEX SERVICES

Role-

EquityDealer

share marketcross sellingthird party productsclient acquisitionequity dealer

Linux Engineer
Angel and Genie 4.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Linux (Plesk) Engineers role with us is a strategic bridge between development and IT operations, taking on operational tasks to ensure the efficient functioning of complete infrastructure and it...
linuxhatplesk

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Angular Developer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 2.00 to 7.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

1- Strong knowledge and hands-on development experience in Angular 6 & above is a must. 2- Proficient with web technologies - HTML5, CSS3, JSON and writing cross-browser...
gittesting debuggingangular developmentangular clirxjsresponsive design

Labourer
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Patna 01 Apr, 2025

General laborers perform manual duties set out by supervisors. General laborers responsibilities include working with power tools, maintaining a clean work environment and receiving goods. ALabor...
communicationtechnologyliteracybasicinstructionsnumeracyfollowskillsstamina

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

office itor
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Bangalore, Chennai, Hyderabad, Kolkata, Chittoor, Chandigarh, Ahmedabad 01 Apr, 2025

Janitors work to keep schools, offices, libraries, and hospitals, clean and maintained. They are often asked to work outside normal business hours sometimes early in the morning or late at night ...
adaptabilitycommunication skillsindependencetime managementproblem-solvingphysical stamina

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Kochi, Hyderabad, Kollam, Thiruvanananthapuram, Mumbai Ci 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Del 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Coordinator Backend office work, Home based work
Divine HR Services 0.00 to 1.00 Years Ernakulam,Bangalore, Madurai, Chennai, Hyderabad, Other Madhya Pradesh, Kanyakumari, Pondicherry, Th 01 Apr, 2025

Job Description Dear candidate, Home Based Job& Limited Vacancy Apply Now. J P G TO MS-WORD Data Typing work simply data entry job. Our company hiring every month fresher for typingback officeenglish typingenglish writingback office operationspart timedata entrycomputer operating

Procurement Assistant
SHARMA ENTERPRISES 1.00 to 6.00 Years Ernakulam,Kochi, Kozhikode, Malappuram, Thrissur, Gwalior, Indore, Bokaro, Ranchi, Bhopal 01 Apr, 2025

We are currently searching for a Procurement Assistant supports the purchasing and supply chain processes, assisting with tasks like sourcing suppliers, preparing purchase orders, maintaining pro...
purchase operationssupplier quality assurancesourcing materialsinventory managementrecord maintenancedata analysisrecord keeping

Floorman vacancy
Apex Offshore Services 0.00 to 1.00 Years Ernakulam,Idukki, Kochi, Kozhikode, Palakkad, Thrissur, Other Madhya Pradesh, Vishakhapatnam, Kakina 01 Apr, 2025

Greeting Walk-in Interview starts in Mumbai we are hiring for the position of Floormanwith a leading Oil & Gas Industry Job Responsi...
gasdrillingoffshore platformsoildiploma in drilling engineer

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Audit Associate
Emrys Creatives 3.00 to 7.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description EMRYS Global LLC offers professional services in tax, accounts audit, legal consulting, and outsourcing. The company provides clever solutions for various financial problems u...
financial statement analysisfinancial auditsanalytical skills

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Operation Manager
digibiz build on quality rating pvt ltd 5.00 to 9.00 Years Kozhikode,Other Kerala 01 Apr, 2025

1. Project Management: - Plan, organize, and execute construction projects from initiation to completion. - Coordinate with District managers to ensure timely delivery within budgetary constrain...
Project ManagementResource ManagementQuality AssuranceTeam Leadership

Admin Executive
MUTHOOT HONDA 2.00 to 6.00 Years Other Kerala 01 Apr, 2025

Providing assistance to the HR team in recruitment and onboarding. Providing support in ABS-wide (asset-backed securities) projects. Managing calendar as well as associated operations. Other tas...
RecruitmentOnboardingCalendar ManagementTravel PlanningAdministrative SupportAssetbacked securitiesDocumentation PreparationMeeting Organization

Sr DOTNET Developer (MVC)
TPHRC PVT LTD 7.00 to 11.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Experience: 7-8 Years Minimum Location: Trivandrum Mode Of work: On Site Responsibilities: Build and maintain application functionality for new and existing systems using the .Net toolset with...
Entity FrameworkSQL ServerHTMLCSSJavaScriptjQueryMVC FrameworkWeb servicesXMLASPNETASPNET CoreEntity Framework CoreREST Web APIs

Technical Content Writer ( 1 year Exp. )
Zennode Technologies 1.00 to 5.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Calicut As an ideal candidate, you should have proven experience in a highly technical field, such as software development, computer science, or engineering. Your ability to evaluate and analyze ...
software developmentcomputer scienceengineeringwritten communicationverbal communicationuser experience designUI design

NOMD Technologies - Full Stack Developer - .Net/AngularJS
NOMD Technologies 4.00 to 8.00 Years Kochi,Other Kerala 01 Apr, 2025

Full Stack Developer-Immediate Joiners. Job Description. We are seeking a skilled Full Stack Developer with minimum 3.5 years of expertise in of ASP.NET Core, the latest Angular versions, Entit...
AngularEntity FrameworkLINQSQLJavaScriptHTML5CSS3GitAgile methodologiesASPNET CoreMediator Pattern

Guest Relations Executive
GREATBELL HR Consultancy Services (P) Ltd 1.00 to 5.00 Years Wayanad,Other Kerala 01 Apr, 2025

Skills: Customer Service, Hospitality Industry, Guest Relations, Front Office Operations, Front office, Aviation, Hospitality Management, Resort, Company Overview GREATBELL HR Consultancy Servic...
Customer ServiceHospitality IndustryGuest RelationsFront Office OperationsFront officeAviationHospitality Management

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Hr Recruiter
SHIVANT HR CONSULTANCY 1.00 to 6.00 Years Delhi 01 Apr, 2025

DearCandidate, Hope you are doing well! Please find below JD for Talent Acquisition - HR Role & responsibilities * Sourcing & screening the CVs from Portal. * Conducting Telephonic Interview...
recruitmentscreening

Urgent |International Sales Executives (Immigration Process) Okhla , Delhi
Sharda Consultancy Services 1.00 to 6.00 Years Delhi,Noida 01 Apr, 2025

Dear Candidates, We are lookingInternational Sales Executives (Immigration outbound sales ) in Okhla ,Delhi Salary upto 50k Medical Insurance Shift Time -12 pm to 9 pm Job description
...
customer supportupsellingsalesinternational bpoprocesslead generationvoice processsales supportimmigrationinternational voicetelesales

International Lead Generation
AVA PLACEMENT SERVICES 0.00 to 3.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Urgent Looking for- (International Outbound Process) Job Title: International Lead Generation Executive LOCATION- NOIDA SECTOR 1/2 NEAR BY METRO 15 NOIDA BOTH AR...
international call centerinternational voice processoutbound salescustomer serviceinternational bpocustomer supportinternational sales

Fashion Model
ATUL PAL Hiring For Gypsum India Ltd 1.00 to 6.00 Years Delhi,Hyderabad, Kolkata, Mumbai City, Chandigarh 01 Apr, 2025

Primary Responsibilities:

Styling Services

Develop innovative and trendsetting fashion looks for photoshoots and SOCIAL MEDIA content

Curate ACC...
modelingfashionfashion communicationphotographic modelling

French Language Expert
Wehire Talent Solutions 0.00 to 4.00 Years Delhi,Noida, Bangalore, Nellore, Hyderabad, Other Andhra Pradesh, Pondicherry, Gurugram, Pune, Mumba 01 Apr, 2025

Job Title: French Language Interpreter (Remote) Salary: Up to 11 LPA CTC (Based on interview performance and last drawn salary) We are looking...
english writingb2 certification in frenchfrench speaking

Equity Dealer
Apex Services Hiring For One of the leading broking firm 2.00 to 5.00 Years Delhi,Faridabad, Noida, Jaipur, Jodhpur, Gurugram 01 Apr, 2025

JD Relationship Manager- Dealing:- As part of the retail distribution team, the role holder is responsible to provide compliant financial advisory services to clients and...
dematnismcross sellingstock market

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Delhi,Noida, Jaipur, Gurugram, Chandigarh 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

Administrative Manager
Institute of Selection 5.00 to 10.00 Years Delhi,Mathura, Agra 01 Apr, 2025

Job Title: Assistant ADMIN Manager Location: Chhata, Mathura Department: P&&A Reports To: P&&A Manager Salary: INR 30,000/- to 50,000/- Job Summary The Admin Manager is responsible for overseeing...
budgetprocurementnegotiationpricing strategycoordination

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Ethiopia, Bangladesh, Anantpur, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

PREV
NEXT

financial advisory services Job Openings

Key Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing