financial consultant jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

financial consultant Job Openings

Showing 11251 - 11300 of 33134 Jobs

Sales Manager (Forex & Comex)

Signal Expert Global 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Cold Calling

Sales Strategies

Relationship Management

SalesMarketing Skills

Global Market Knowledge

Finance Associate

Intent 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Xero

QuickBooks

Microsoft Excel

Opening Senior Accountant

TALENT MAX HR & MANGAGEMENT CONSULTANT 10.00 to 15.00 Years Indore 01 Apr, 2025

Job Opening: Senior Accountant

Location:

Experience: income tax actaccounting standardsdirect tax

Equity Research Analyst
Jobsense 1.00 to 3.00 Years Indore 01 Apr, 2025

We are a hardcore research, analytics provider. Started building a track record of growth, a culture of innovative solutions which sets us apart. We are delivering our opinions, actionable insigh...
fundamental analysisequity valuationequity researchqualitative analysisfinancial modelingequity analysis

Relationship Manager
DREAMS SOLUTIONS 0.00 to 3.00 Years Indore 01 Apr, 2025

We hiring For Relationship Manager And Advisor For -INDORE/ NOIDA/ MUMBAI Experince-6 Month to 2 year Key Responsibilities...
salesdirect marketingdemat accounts

Hardware & Networking Engineer (Night Shift)
TALENT MAX HR & MANGAGEMENT CONSULTANT 1.00 to 4.00 Years Indore 01 Apr, 2025

Job Title: Hardware & Networking Engineer (Night Shift) Experience: 1-2 Years Salary: 2-3 LPA Location: Indore Palasiye Shift: Night Shift We are looking for a Hardware & Networking Enginee...
networkingnetwork administration

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Vijayawada, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Opening for Freelance Recruiter with Talentsphere Management Services
Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Greetings from Talentsphere Management Services! I hope youre doing well. We are excited to introduce a fantastic opportunity for you to collaborate with us a...
screening resumesexecutive searchfreelance recruitmentrecruitmentnon it recruitmenttechnical recruitingit recruitment

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Hiring for Field Sales Executive in Delhi NCR
AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description Job Title: Sales Consultant Location: Delhi NCR Salary: 25000 CTC (Including Petrol allowance of 2000) Experience: 0-1 year Qualification : Graduate ...
salesfield salessales executive activities

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Audit Associate
Emrys Creatives 3.00 to 7.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description EMRYS Global LLC offers professional services in tax, accounts audit, legal consulting, and outsourcing. The company provides clever solutions for various financial problems u...
financial statement analysisfinancial auditsanalytical skills

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Direct Sales Consultant
AL RAZ International Business Links 0.00 to 4.00 Years Other Kerala 01 Apr, 2025

Post:DIRECT SALES CONSULTANT Location:TIRUR Salary package:12K TO 18K Working time:9.30AM TO 5.00PM Male or female:BOTH Food and accommodation:NO Qualification:ANY DEGREE OR DIPLOMA Experie...
Direct Sales

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Divisional Manager
TEAMWORK CABLES PRIVATE LIMITED 16.00 to 25.00 Years Kannur,Kasargod, Kottayam, Kozhikode, Malappuram, Thiruvanananthapuram, Bangalore, Chennai, Mangalor 01 Apr, 2025

The Division Manager plays a vital role in overseeing and managing the operations of an entire division within the company. This position requires a blend of strategic oversight, operational manag...
foreign assistanceindustrial policymanagerial economicstrade negotiationoperating agreementsindustrial economicstrade agreementsdivision ordersmanager

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Delhi,Gurugram 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

International Lead Generation
AVA PLACEMENT SERVICES 0.00 to 3.00 Years Delhi,Ghaziabad, Noida 01 Apr, 2025

Urgent Looking for- (International Outbound Process) Job Title: International Lead Generation Executive LOCATION- NOIDA SECTOR 1/2 NEAR BY METRO 15 NOIDA BOTH AR...
international call centerinternational voice processoutbound salescustomer serviceinternational bpocustomer supportinternational sales

Equity Dealer
Apex Services Hiring For One of the leading broking firm 2.00 to 5.00 Years Delhi,Faridabad, Noida, Jaipur, Jodhpur, Gurugram 01 Apr, 2025

JD Relationship Manager- Dealing:- As part of the retail distribution team, the role holder is responsible to provide compliant financial advisory services to clients and...
dematnismcross sellingstock market

Urgent Hiring for Personal Loan Sales Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Delhi 01 Apr, 2025

A well-defined job description sets clear expectations and attracts suitable candidates. Below is a template tailored for a Loan Sales Executive role: Job T...
loan salespersonal loans

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Team Manager
ASHISH INVESTMENT SERVICES 15.00 to 25.00 Years Delhi 01 Apr, 2025

Profile: Associate Agency Development About the Company: Kotak Mahindra Life Insuranceis a fast-growing organization recognized for its100%succ...
salesbusiness developmentteam managementlead generation

Urgent Opening- Financial Planning & Analyst- Manufacturing Industry- Delhi
Topgear Consultants Private Limited 2.00 to 7.00 Years Delhi 01 Apr, 2025

Hiring with a leading Manufacturing industry for their office in Delhi. Role: Financial planning & Analysis Qualification - MBA/CA Location: Delhi analysisfinancial planningbudgetingplanningvariance analysisforecastingmodelling

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

DSA Manager (Gold loan)
DREAMS SOLUTIONS 1.00 to 4.00 Years Chandigarh 01 Apr, 2025

We are hiring for Leading finance company - Profile- DSA Manager (Gold loan) Location - Chandigarh Min 1 years exp required in DSA Handling for any loan. graduation mandatory Local Candidate...
salesdsa management

PREV
NEXT

financial consultant Job Openings

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers