Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

forensics investigation Job Openings

Showing 0 - 50 of 1090 Jobs

Operation Coordinator

TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida 20 Aug, 2026

Job Description Operations Coordinator

Job Title

Operations Coordinator

Department

Location

Job Type

desktop intelligence

ms excel

Liaison Officer

TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Delhi, FaridabadFaridabad, Ghaziabad, Noida, Dharwad, Bellary, Gurugram 20 Aug, 2026

Job Description Executive Action & Liaison

Location:

Experience:

Industry:

due diligence

intelligence gathering

field investigations

risk management

government liaison

Install Operation Manager, reputed company Key

FlexBoard 1.00 to 10.00 Years All India 17 Aug, 2026

vendor management

program management

relationship management

data analysis

sales operations

stakeholder management

technical knowledge

customer technical support

hardware

reputed company reputed company Data Operations Analyst Data Entry and

FlexBoard 1.00 to 10.00 Years All India 17 Aug, 2026

Implementation Operations Manager (Remote)

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

Engineering Management

Operations Management

Team Management

Problem Solving

Software Engineering

Technical Troubleshooting

Documentation

Senior Regulatory Operations Analyst (India)

Leading 1.00 to 10.00 Years All India 17 Aug, 2026

Remote Senior Operations Analyst DataDriven Insights and Resource Planning

remote next 1.00 to 10.00 Years All India 17 Aug, 2026

Predictive Modeling

Forecasting

Performance Reporting

Extraction

Statistical Analysis

Model Development

Resource Utilization Analysis

Industry Trend Analysis

Data Sourcing

Medical Officer Claims Processor

Square Business Services Pvt Ltd 1.00 to 10.00 Years Raipur 17 Aug, 2026

Location:

Experience:

Employment Type:

pharmacology

terminology

Data Analyst ( Data Science ) Chennai, Tamil Nadu, India

Arcadia Power, Inc 1.00 to 10.00 Years Chennai 17 Aug, 2026

Exploratory Data Analysis

Remote Customer Service Representative Florida FullTime Remote Role

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

Escalation Management

InboundOutbound Communication

MultiChannel Support

UpsellingCrossSelling

Detailed Documentation

Product Knowledge Mastery

Quality AssuranceKPI Achievement

Trend Reporting

System Issue Reporting

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Noida, Nepal, Hyderab 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Nepal, Hyderaba 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Chennai, EthiopiaEthiopia, Bangladesh, South Africa, Bangalore, Noida, Nepal, Hyderabad, Kolkata, Un 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Cluster Medical Director Mumbai

Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City 06 Aug, 2026

REQUIRED SAFETY SUPERVISOR DABUR INDIA LIMITED

SUMIT KUMAR NEGI 1.00 to 10.00 Years Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Thane, Maharashtra, Bhubaneswar, Bokaro, Jharkhand 03 Aug, 2026

Contact Person :87,96,58,83,40 Rita Mam

Safety Supervisor Dabur India Limited (Job Description)

safetyregulatory complianceemergency responsesafety officer activitiesrisk managementsafety managementsafety trainingcommunicationsafety audit

Returnship - TM-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a senior claims subject matter expert within a hybrid work model night shift environment applying deep knowledge of HIPAA claims adjudication and both provider and payer ope...
provider relationscustomer experienceuser acceptance testingHIPAA claims adjudicationproviderpayer operationshealth care claims processingHIPAA regulationsprovider reimbursement methodologiespayer domain expertise

Remote Senior Operations Analyst Data-Driven Insights & Resource Planning
remote next 1.00 to 10.00 Years All India 01 Aug, 2026

Join arenaflex Where Data Meets Innovation in the Travel Industry Are you reputed company to be part of a dynamic team thats transforming how a global leader serves millions of customers arenafle...
SQLPythonTableauanalytical skillscommunication skillsMS Officedata visualizationstatistical analysisproject management

Auditing Mgr- CS
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 31 Jul, 2026

Leading Financial services company requires Deputy Mgr/Mgr (Auditing and compliance)- - Mulund-Mumbai ( Only company secretary qualified need apply) One of our client a leading Financial servic...
company secretarial functionscompany secretarial workamalgamationcompanies actsebi regulations

Walkin drive for Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 31 Jul, 2026

HCLTech | Walk-In Drive | Fraud Analyst | 1st Aug 26 | Bangalore Date: 1st Aug 26 (Saturday) Timing:<...
fraud analysisfraud investigationfraud managementfraud controlfraud detection

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 28 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Urgent | Health Claim Facilitator | Mumbai
Shree Balaji Employment Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

We Are Hiring Health Claim Facilitator Location: Mumbai Key Responsibilities:

Managed cashless and reimbursement health insurance c...
visitclaim investigationfield work

Assistant Manager - Application Security
knowledge Artisan 1.00 to 10.00 Years Kochi 28 Jul, 2026

Were Hiring : Assistant Manager Application Security, IT Audit & GRC (2 Positions) Location : Kochi, Kerala Work Mode : On-site Employment Type : Full-Time Salary : Not a constraint for ...
Application SecuritySecure SDLCVAPTVulnerability ManagementGRCRisk ManagementSecurity ToolsIT Security AuditsERPApplication Security Reviews

Fraud Analyst AML KYC Banking Operations Chargebacks 1PlusYrs | Hyd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 28 Jul, 2026

Job Description (JD) Fraud Analyst | AML/KYC | Banking Operations Location: Hyderabad Experience: 14 Years CTC: Up to 4 LPA Shift: US Rotational Shift Notice Period: Immediate to 15 Days Pref...
Fraud InvestigationFraud DetectionAMLAnti Money LaunderingKYCFraud AnalystFraud Operations

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Inventory Control Manager
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, MoradabadMoradabad, Ghaziabad, Lucknow, Varanasi, Firozabad, Faizabad, Agra, Hyderabad, Kolk 22 Jul, 2026

An Inventory Control Manager team supervisiondatatechnicalanalysistime managementanalyticalforecastingskills

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

SOC & NOC Analyst
Muthoot Microfin 1.00 to 10.00 Years Kochi 22 Jul, 2026

Role & responsibilities Monitor alerts generated by SOC and NOC tools. Perform first-level analysis and ticket creation. Escalate incidents based on defined procedures. Monitor server, network...
Network Monitoring ToolsBasic NetworkingWindowsLinux FundamentalsSecurity Monitoring ConceptsEndpoint Security ToolsIncident Ticket ManagementBasic Cloud ConceptsCybersecurity FundamentalsSIEM Monitoring

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BhopalBhopal, Bangalore, Noida, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Hyderabad, PurniaPurnia, Guntur, Bangalore, Bhagalpur, Chennai, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Purnia, Bangalore, Bhagalpur, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Ahmedabad, MundraMundra, Mumbai City, Varanasi, Pune, Delhi 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Lucknow, NoidaNoida, Delhi, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Varanasi, DelhiDelhi, Pune, Mumbai City, Mundra, Ahmedabad 22 Jul, 2026

Urgent Requirements Post - Safety Supervisor Experience - 1yr to 5yr Salary - 20,000 to 40,000 location - Pune, Mumbai, Mundra, Ahmedabad, Delhi, Varanasi Site - Industrial,...
safety trainingsafety management systemsafety analysissafety engineeringsafety auditsafety inspection

Safety Officer
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Bangalore, PurniaPurnia, Guntur, Bhagalpur, Chennai, Hyderabad, East Siang, Dibang Valley, Bhillai, 22 Jul, 2026

We are looking to employ a qualified and competent safety officer who will be responsible for the health and safety of staff in the workplace. The safety officer will compile safety programs and ...
occupational healthhealthsafetysecurityindustrial safetyinspectionaccident investigationworkplace safetysafety training

AGM - Downstream Processing
Cadila Pharmaceuticals Ltd 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Role Overview Department: DSP Designation: AGM Reporting To: General Manager Principal Tasks and Responsibilities Lead and supervise the downstream processi...
hplcanalytical developmentdownstream processing

Cyber Security Threat Detection and Response Operations Manager
Ernst & Young LLP ( EY India ) 1.00 to 10.00 Years Thiruvananthapuram 20 Jul, 2026

TC - CS - CDR - SOC - Manager At EY, were all in to shape your future with confidence. Well help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you w...
Security MonitoringCloud SecurityProject ManagementPerl scriptingSIEM technologiesCyber Incident ResponseIOTOTEndpoint ProtectionRegEx

AML Operations Analyst AML Quality Control (AML QC)
Gratitude Inc 1.00 to 10.00 Years Chennai 20 Jul, 2026

AML Operations Analyst AML Quality Control (AML QC) | Bangalore / Chennai | Up to 12.5 LPA Location: Bangalore or Chennai Experience: 10 Years Salary: Up to 12.5 LPA Band: BPO 3/4 Hiring: Immedi...
Transaction MonitoringRisk AssessmentRegulatory ComplianceDocumentationReport WritingAML OperationsFinancial Crime ComplianceAML Quality ControlFCRM systems

Cyber Security Operations Analyst
Cybage 1.00 to 10.00 Years Mumbai City 20 Jul, 2026

Department Engineering Location Pune Work Experience 6years About The Position The Senior Security Operations Analyst will be responsible for monitoring security alerts, in...
Security OperationsSOCInfrastructure SecurityEnterprise Security SupportCrowdStrike EDRCrowdStrike NextGen SIEMZscalerForescout NACDLP Solutions

MBA Hiring | Manager - Health Claims (Claims MIS & Operations Analyst) (Uttar
TATA AIG General Insurance Company 1.00 to 10.00 Years All India 20 Jul, 2026

Role & responsibilities: - Maintaining, tracking, and analyzing claim savings, high-value claims, pending queries, dependencies, and other operational data. - Analyze key claims performance metr...
Analytical skillsClaim processingData analysisOperations managementCommunication skillsExcelSQL

Retail Banking Fraud Operations Analyst Hyderabad
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 20 Jul, 2026

Retail Banking Fraud Operations Analyst Location: Hyderabad Experience: 1 to 5 Years CTC: Up to 5.5 LPA Qualification: Any Graduate Shift: US Shift Notice Period: Immediate Joiners or Candi...
Fraud DetectionFraud InvestigationChargebacksBanking OperationsRetail Banking Fraud OperationsFraud Analyst

Global Payments Credit Risk/Fraud Analyst 2 Years Bangalore
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Hiring | Global Payments Credit Risk/Fraud Analyst | 2 Years | Up to 5.5 LPA | Bangalore Location: Bangalore Experience: 2 Years CTC: Up to 5.5 LPA Qualification: Any Graduate Notice Period:...
transaction monitoringfraud operationspayment operationsfraud analystglobal paymentscredit risk analyst

Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 20 Jul, 2026

Job Description Analyst Fraud Ops Designation Analyst/Sr Analyst Work Location Bengaluru (Cessna business park) Work From Office (5 days) Shifts Night Shifts (PST Time zone) ...
suspicious activity reportingfraud detectionimpersonationsfraud analysisfraud investigation

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Bhubaneswar, CuttackCuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Bihar, Patna, Hari 17 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 17 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Patna, BangaloreBangalore, Noida, Indore, Hyderabad, Lucknow, Jamshedpur, Pune, Delhi, Bhopal 17 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

NEXT

forensics investigation Jobs

forensics investigation Job Openings

Job Description Operations Coordinator

Job Title

Department

Location

Job Type

Safety Supervisor Dabur India Limited (Job Description)

Contact Person :97,17,22,36,28 Renu Mam

Job Description

Contact Person :97,17,22,36,28 Renu Mam

Contact Person :97,17,22,36,28 Renu Mam

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers