healthcare jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

healthcare Job Openings

Showing 6601 - 6650 of 10667 Jobs

Vlocity Lead / Architect

Wroots Global Private Limited 10.00 to 18.00 Years Pune,Bangalore, Hyderabad, Mumbai City 29 Oct, 2024

Role :Salesforce Vlocity Lead / Architect

Requirements:

salesforceomniscriptexpertisedataraptorvlocity

AthenaOne Systems Analyst Role (Pan India)

Wroots Global Private Limited 7.00 to 12.00 Years Pune,Bangalore, Chennai, Noida, Ghaziabad, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 29 Oct, 2024

AthenaOne Systems Analyst

Sr. Developer (Genero 4GL) IRC240794

Hitachi Careers 8.00 to 12.00 Years Noida,Other Uttar Pradesh 29 Oct, 2024

WindowsWeb applications

OOPS concepts

AgileScrum

Recruitment Business Partner

NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Noida,Delhi, Bangalore, Ongole, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

AthenaOne Systems Analyst Role (Pan India)

Wroots Global Private Limited 7.00 to 12.00 Years Noida,Delhi, Ghaziabad, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

AthenaOne Systems Analyst

Medical Copywriter

RENUKA INTERPRISES 0.00 to 4.00 Years Mangalore,Chennai, Bangalore, Belgaum, Hubli, Oman, Qatar, Saudi Arabia, Ahmedabad, Kuwait, Kochi, N 29 Oct, 2024

Clinical Assistant

NEW ERA LIFE CARE PRIVATE LIMITED 3.00 to 8.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi, Anantpur 29 Oct, 2024

Biomedical Technician

LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Mumbai City,Pune, Zimbabwe, Mozambique, Bangalore, Noida, Chennai, United Arab Emirates, Hyderabad, 29 Oct, 2024

biomedical engineering

healthcare

healthcare operations

medical equipment planning

biomedical electronics

nutritionist

analyst

AthenaOne Systems Analyst Role (Pan India)

Wroots Global Private Limited 7.00 to 12.00 Years Mumbai City,Pune, Bangalore, Chennai, Noida, Ghaziabad, Hyderabad, Kolkata, Gurugram, Delhi 29 Oct, 2024

AthenaOne Systems Analyst

Hiring For Billing Clerk

Latisha Interprises 0.00 to 3.00 Years Hyderabad,Nizamabad, Dehradun, Jaipur, Cuttack, Indore, United Arab Emirates, Vijayawada, Vishakhapa 29 Oct, 2024

Wanted Life science Fresher

CORE 2 CODE Hiring For core2code 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Coimbatore 29 Oct, 2024

Must be a graduate in life science (Life Science Graduates lik...
sciencetypingpathologyanatomy

Logistics Manager

Ranjay Kumar Hiring For Shree Aarya Logistics 0.00 to 4.00 Years Hyderabad,Bhubaneswar, Dehradun, Jaipur, Other Maharashtra, Other Odisha, Udaipur, Aurangabad, Samba 29 Oct, 2024

logistics

logistics operations

logistics management

logistics coordination

Medical Coder

I Skills Coding Solutions 0.00 to 3.00 Years Hyderabad,Chennai, Salem, Other Kerala, Vellore, Other Karnataka, Coimbatore 29 Oct, 2024

Job Profile:

cpt coding

medical coding

hipaa regulations

Relationship Manager

MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Key Responsibilities:

Client Acquisition & Relationship Management: Acquire new clients in the healthcare sector and build strong relationships with k...
wholesale bankingsmehealthcarebusiness bankingworking capitalrelationship managementsme lendingcost accountant

Director, Operations

TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Kurnool, Austria, Canada, Amalapuram, Papum Pare, Anjaw, Machilipatnam, Tirap, Changlang, 29 Oct, 2024

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t...
overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Child Life Specialist

NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Noida, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

Recruitment Business Partner

NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Hyderabad,Bangalore, Ongole, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Medical Coding for Nutrition and Dietitian Wanted -CT Priya

Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Madurai, Bangalore, Chennai, Salem, Thoothukudi, Tiruchirappalli, Vellore, Coim 29 Oct, 2024

Medical Coding Job

hidden_mobile

Position: Medical Coder

Medical Coding - General Life Science , clinical nutrition Grad -CT Priya

Alpha Medical Coding Solutions 0.00 to 2.00 Years Hyderabad,Thanjavur, Bangalore, Madurai, Chennai, Salem, Thoothukudi, Tiruchirappalli, Vellore, Coim 29 Oct, 2024

Medical Coding Job

CT HR Gokulapriya-hidden_mobile(Whatsapp )

Position: Medical Coder

pharmacymedical codingbiotechnologybptmptphysiotherapybiochemistrynursingzoology

Vlocity Lead / Architect
Wroots Global Private Limited 10.00 to 18.00 Years Hyderabad,Bangalore, Pune, Mumbai City 29 Oct, 2024

Role :Salesforce Vlocity Lead / Architect Requirements:

salesforceomniscriptexpertisedataraptorvlocity

AthenaOne Systems Analyst Role (Pan India)
Wroots Global Private Limited 7.00 to 12.00 Years Hyderabad,Bangalore, Chennai, Noida, Ghaziabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are currently looking for anAthenaOne Systems Analystto join our team in (Pan India). This role involves supporting, configuring, and troubleshooting the AthenaOne EMR system,...
emrathenacollectorclinicals

Clinical Assistant
NEW ERA LIFE CARE PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Anantpur 29 Oct, 2024

We are looking for a Clinical Assistant to join our team to help create a positive experience for our patients whenever they visit our facility. Clinical Assistant responsibilities include welco...
entrycustomercompassionsurgicalprocedureshipaabloodpressuredataservicecarepatientcallsphoneexamdirect

AthenaOne Systems Analyst Role (Pan India)
Wroots Global Private Limited 7.00 to 12.00 Years Gurugram,Delhi, Ghaziabad, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are currently looking for anAthenaOne Systems Analystto join our team in (Pan India). This role involves supporting, configuring, and troubleshooting the AthenaOne EMR system,...
emrathenacollectorclinicals

Relationship Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 29 Oct, 2024

Key Responsibilities:

Client Acquisition & Relationship Management: Acquire new clients in the healthcare sector and build strong relationships with k...
wholesale bankingsmehealthcarebusiness bankingworking capitalrelationship managementsme lendingcost accountant

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Gurugram,Delhi, Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Ko 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Gurugram,Delhi, Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Ko 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Hospitality Manager
AES INDUSTRIAL PRIVATE LIMITED 9.00 to 14.00 Years Delhi,Botswana, Bangladesh, Qatar, South Africa, South Korea, Bangalore, Ernakulam, Chennai, Idukki, 29 Oct, 2024

A Hospitality Manager is a professional responsible for organizing and overseeing the daily operations of facilities in the hospitality industry. They hire qualified personnel, coordinate operati...
hotel asset managementhospital administrationchefhotel operationsprofit managerhealthcare industryhotel accountshospital managementpatient safety

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gur 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gur 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

Clinical Assistant
NEW ERA LIFE CARE PRIVATE LIMITED 3.00 to 8.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Anantpur 29 Oct, 2024

We are looking for a Clinical Assistant to join our team to help create a positive experience for our patients whenever they visit our facility. Clinical Assistant responsibilities include welco...
entrycustomercompassionsurgicalprocedureshipaabloodpressuredataservicecarepatientcallsphoneexamdirect

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Delhi,Noida, Zimbabwe, Mozambique, Bangalore, Chennai, United Arab Emirates, Hyderabad, Kolkata, Gur 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

AthenaOne Systems Analyst Role (Pan India)
Wroots Global Private Limited 7.00 to 12.00 Years Delhi,Ghaziabad, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City 29 Oct, 2024

We are currently looking for anAthenaOne Systems Analystto join our team in (Pan India). This role involves supporting, configuring, and troubleshooting the AthenaOne EMR system,...
emrathenacollectorclinicals

Chief Executive Officer
Pecus Healthcare Pvt Ltd 10.00 to 14.00 Years Chandigarh 29 Oct, 2024

We are urgently hiring Chief Executive Officer for Chandigarh location. Responsibilities: Take lead across all aspects of the company and developing effective policies to make all departments wo...
Team LeadershipStrategic PlanningCommunication SkillsTeam BuildingCollaborationCrisis ManagementVeterinary Pharma Industry Knowledge

Excellent Opening for Surgery Coders
CORE 2 CODE Hiring For Medical coder 0.00 to 2.00 Years Chennai,Tiruvannamalai, Viluppuram, Thoothukudi, Kanchipuram, Nagapattinam, Other Andhra Pradesh 29 Oct, 2024

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off...
medical terminologyanatomyteam management skillscommunication skillsanalytical skills

Senior Ar Caller
Das Manpower Consultancy Services 0.00 to 3.00 Years Chennai 29 Oct, 2024

Greetings, From DCS Jobs! Designation: Senior AR Caller 12/ Diploma / Any graduate Min 8 months experience in denial management Notice accepted upto 20 days Salary: Negotiable Fixed weekend...
us healthcarecommunicationphysician billing

Hospital Administrator and admin staffs
Freelancerroshan 0.00 to 4.00 Years Chennai,Bangalore, Hyderabad, Canada, Kolkata, Pune, Mumbai City 29 Oct, 2024

We are looking for a responsible Hospital Administrator to coordinate our medical services. For this role, you should understand healthcare regulations and be able to handle medical information ...
administration managementgeneral administrationmanagement

Senior Solutions Manager
OMEGA HEALTHCARE MANAGEMENT SERVICES PRIVATE LIMITED 10.00 to 16.00 Years Chennai,Bangalore 29 Oct, 2024

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales

Hospitality Manager
AES INDUSTRIAL PRIVATE LIMITED 9.00 to 14.00 Years Chennai,Botswana, Bangladesh, Qatar, South Africa, South Korea, Bangalore, Ernakulam, Idukki, North 29 Oct, 2024

A Hospitality Manager is a professional responsible for organizing and overseeing the daily operations of facilities in the hospitality industry. They hire qualified personnel, coordinate operati...
hotel asset managementhospital administrationchefhotel operationsprofit managerhealthcare industryhotel accountshospital managementpatient safety

Medical Coding For Biochemistry,Bioinformatics,Microbiology -CT Karthika hr
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
pharmabiomedicalmedical codingnursingbiotechnology industrylife science industryzoologybiochemistry

Biomedical Technician
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Chennai,Zimbabwe, Mozambique, Bangalore, Noida, United Arab Emirates, Hyderabad, Kolkata, Gurugram, 29 Oct, 2024

We are looking for a dynamic biomedical technician to join our biomedical department. In this role, youll be in charge of overseeing the care and use of all biomedical equipment, performing machi...
biomedical engineeringhealthcarehealthcare operationsmedical equipment planningclinical engineeringcardiologybiomedicaltechnical processbiomedical electronicsnutritionistanalyst

AR Caller - Senior AR Caller - Denial Management (Executive)
Starworth Global Solutions 0.00 to 4.00 Years Chennai 29 Oct, 2024

Job description Position / Title :Executive - AR / Senior Executive - AR ( Denial Management ) Responsibility Areas: EXP : Minimum 1 Yrs 1. Should handle US Healthcare providers/ Physicians/ ...
ar calling medical billingus healthcarehospital billingdenial managementphysician billingar calling

Recruitment Business Partner
NEW ERA LIFE CARE PRIVATE LIMITED 17.00 to 23.00 Years Chennai,Bangalore, Ongole, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Recruitment Business Partner to join our HR department and help develop and implement successful recruiting strategies. Recruitment Business Partner responsibilities include...
customerbusinessmanagementanalyticsperformanceserviceengagementhealthcareexcellentresourcesemployeehumaninterpersonalprojectobjectivesservices

Java Architect
UST Global 12.00 to 22.00 Years Chennai,Kochi, Thiruvananthapuram 29 Oct, 2024

Java Architect Location: Chennai, Trivandrum,Kochi Notice: Immediate-30 Days We are seeking a highly experienced Java Architect with a proven track record in delivering large-s...
solution architecturejavasolution design

Medical Coding Wanted Biomedical, BSc, Nutrition Grad- Ct Priya
Alpha Medical Coding Solutions 0.00 to 2.00 Years Chennai,Tirupati, Vellore, Thoothukudi, Salem, Tiruchirappalli, Kanyakumari, Kanchipuram, Coimbatore 29 Oct, 2024

Alpha coding Solutions HR Gokulapriya hr hidden_mobile( Whatsapp ur resume) Main branch address:-No-17,JK Complex Ramanathan streetT nager Chennai -17 Medical Code...
biotechnologymedical codingphysiotherapypharmacynursingbiochemistrybiomedicalbiology

Medical Coder -Biomedical, Biotechnology, Biology Grad wanted-Ct Jayapriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
bioinformaticsbhmsmicrobiologyphysiotherapybptbamsmedical codingbiotechnologybiochemistry

Medical Coding for General Lifescience,clinical nutrition Grad-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Kanchipuram, Nagercoil, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
zoologynursingphysiotherapybiochemistrybioinformaticspharmacybiomedicalmedical codingbiotechnology

Medical Coding For B.sc, M.sc, Biology, Botany, Zoology Grad -Ct JayaPriya
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Jayapriya CT -hidden_mobile (Whatsapp ur resume) hidden_email Main branch address:- No-17,JK Complex Ramanat...
medical codingbiochemistrybamsbptmicrobiologybiotechnologybioinformaticsbhmsphysiotherapy

Medical Coding Freshers for Clinical care Technology-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
biochemistryzoologymedical codingbioinformaticsnursingbiomedicalpharmacyphysiotherapybiotechnology

Medical Coding Pharmacy, Physiotherapy, Bds, Nursing Grad-Ct Karthika
Alpha Medical Coding Solutions 0.00 to 4.00 Years Chennai,Pondicherry, Cuddalore, Salem, Kanyakumari, Nagercoil, Kanchipuram, Vilupuram, Coimbatore, K 29 Oct, 2024

Alpha coding Solutions HR Karthiga CT -hidden_mobile (hidden_mobile Whatsapp ur resume) hidden_email Main br...
biomedicalbiochemistrymedical codingbioinformaticspharmacybiotechnologynursingzoologyphysiotherapy

PREV
NEXT

healthcare Job Openings

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t... overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off... medical terminologyanatomyteam management skillscommunication skillsanalytical skills

Job description Solution Development Skill sets Required. Domain expertise in either of the areas: Real World Data solutionspresales

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Full job description About the Role The Director, Operations at AAD is responsible for guiding a t...
overseas marketingexperience operatingoversee manufacturingrole expectationsoversee customer technical

Job description Hi, Excellent opportunity For Coders in Surgery coding! location: Chennai & Coimbatore Work Mode: Work from Off...
medical terminologyanatomyteam management skillscommunication skillsanalytical skills

Job description Solution Development Skill sets Required. Domain expertise in either of the areas:

Real World Data solutionspresales