hiring training developing new employees dot jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

hiring training developing new employees dot Job Openings

Showing 37751 - 37800 of 98895 Jobs

Sr HRBP Associate -Gurugram

MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

hr operations

hrbp

associate

Hiring for Field Sales Executive in Delhi NCR

AASAANJOBS PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Meta Job Description

sales

field sales

sales executive activities

Freshers, Exp - Sales Associates - EV Charger Manufacturer

Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem.

sales coordination

chargers

lithium-ion batteries

battery

Lead Generation Expert

Team Vertex India Global Services Private Limited Hiring For Lead Generation Expert 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Job Title:

Location:

Job Summary:

voice process

international call center

Materials Manager

SHARMA ENTERPRISES 3.00 to 8.00 Years Gurugram,Faridabad, Bhiwani, Hisar, Karnal, Kurukshetra, Panchkula, Ambala, Panipat, Kolkata 01 Apr, 2025

Equity Dealer

Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate,

Greetings From APEX SERVICES

Role-

EquityDealer

share marketcross sellingthird party productsclient acquisitionequity dealer

E-commerce Account Managment Lead - CBT (Cross Border Trade)
ACUITTY CONSULTANTS LLP Hiring For AcuittyTech 1.00 to 2.00 Years Gurugram 01 Apr, 2025

Key Responsibilities: As an e-commerce account manager, you will work with one of the worlds largest companies to guide their partners ( business-to-businesskey account managementaccountabilitycommunication skillsexport import documentationrelationship buildingms excele-commerce account managementproduct listing

Urgent Hiring For the Position of Relationship Manager and Sales Officer
DREAMS SOLUTIONS 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates Greeting For a day ! We have job opening in Banking Sector for the profile of # Relationship Manager personal loanscasa sales

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Linux Engineer
Angel and Genie 4.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Linux (Plesk) Engineers role with us is a strategic bridge between development and IT operations, taking on operational tasks to ensure the efficient functioning of complete infrastructure and it...
linuxhatplesk

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Lead Maintenance Supervisor
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Team Supervision:

Lead, train, and mentor a team of maintenance technicians and staff.

Assign tasks and p...
programmingwellnessinspectionmanagementvalvesschedulingsafety trainingexecutive engineering

German Language Specialist
Wroots Global Private Limited 1.00 to 6.00 Years Gurugram,Jaipur 01 Apr, 2025

Job Title: German Language Specialist International Voice Support Location: Jaipur & Gurgaon voice supportinternational voicecall centre voiceinternational bpogerman translationvoice processcustomer care

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Urgent | Hiring AR Callers
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Delhi, Pune 01 Apr, 2025

Hiring for AR callers Should have worked in End to End RCM and Denials Specialized in hospital billing and physician billing Experience 1 to 4 years Salary Max upto 45 k Location Mohali and p...
ar follow upar calling

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Urgent Vacancy For Data Entry Operator (Work From Home)
MATTRIXX INDIA 0.00 to 4.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Vishakhapatnam, Pune, Mumbai City, Guwahati 01 Apr, 2025

We are looking for candidates who are self- motivated and willing to work from home and have passion in Data Entry. We offer various types of data entries work: Excel Numeric ...
typing 40wpmdata entrytyping speedwork from homedata entry work from homedata entry operation

Customer Care Executive
Elevate X solutions 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Job Title Customer Care Executive Location Gurgaon Salary: 15,000 - 25,000 per month Job Description We are seeking enthusiastic Customer Care Executives for our BPO operations in Gurgaon. Res...
time managementcareer counsellingproblem solvingcustomer careexcel

Area Sales Manager
SARANSH BIO ORGANIC PRIVATE LIMITED 1.00 to 5.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Visit Doctors and other healthcare professional to promote, sell & demonstrate the Lifestyle healthcare Products

Identifying prospective business opportunities for the company....
business developmentpharmaceutical salesarea sales managementayurvedic medicine

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Kochi, Hyderabad, Kollam, Thiruvanananthapuram, Mumbai Ci 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Design Verification Engineer
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED 6.00 to 11.00 Years Kochi,Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Mumbai City, Delhi, Ahmedabad 01 Apr, 2025

Greeting form Globex Digital.! Please find the job description for _Design Verification Engineer interested please revert back with updated resume. JD: Design Verification Engineer Experience:...
uvmsystem verilogdesign verificationsub systems

Project Supervisor
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Agartala, Mumbai City, 01 Apr, 2025

We are looking for a responsibleSupervisorto oversee the workflow at our facilities. The role is acomplex one. He/She will not just be someone who supervises the work of others. ...
project managementtechnical skillscontract managementconstruction managementquality assurance

Material Management Executive
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 19.00 Years Thiruvanananthapuram,Other Maharashtra, Bangalore, Chennai, Other Tamil Nadu, Hyderabad, Kolkata, Mu 01 Apr, 2025

Our growing business is searching for a qualified materials manager to oversee our inventory and purchasing operations. If you are an experienced and competent individual with in-depth knowledge ...
supply chain managementlogistics coordinationpurchase orderscontinuous improvementmaterial planning

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Mumbai City, Del 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

Data Entry Coordinator work,Back Office work
Pick Bright HR Solution 0.00 to 1.00 Years Ernakulam,Kasargod, Thiruvanananthapuram, Bangalore, Tiruvannamalai, Chennai, Hyderabad, Mysore, Oth 01 Apr, 2025

Dear candidate, A simple side job that takes 2 to 3 hours a day. Desired skills and qualities:Basic Computer Knowledge. Laptop/Desktop & Smartphone are required. Training will be provided by ...
backendenglish writingdata entry

Coordinator Backend office work, Home based work
Divine HR Services 0.00 to 1.00 Years Ernakulam,Bangalore, Madurai, Chennai, Hyderabad, Other Madhya Pradesh, Kanyakumari, Pondicherry, Th 01 Apr, 2025

Job Description Dear candidate, Home Based Job& Limited Vacancy Apply Now. J P G TO MS-WORD Data Typing work simply data entry job. Our company hiring every month fresher for typingback officeenglish typingenglish writingback office operationspart timedata entrycomputer operating

Operations Manager
WorkMint 0.00 to 4.00 Years Ernakulam,Idukki, Kannur, Kochi, Kottayam, Malappuram, Palakkad, Pathanamthitta, Thrissur, Wayanad 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Supervise and lead a team of banking professionals, providing guidance and support. Monitor and analyze operational perfo...
back officeoperationsbackend operationsback office operationsback office processing

Telecaller
Quess Corp (Magna Infotech) Fresher Other Kerala 01 Apr, 2025

Company. Name :- Bajaj Finance Ltd. WORK FROM HOME (Full Time) Job Role :- Tele calling Working Days :- Monday to Saturday Working Hours :- 9am to 6pm Salary :- 11,000/- in hand - Information or ...
telecallingcustomer service

Online Back Office Executive, Data Entry coordinator work
Pick Bright HR Solution 0.00 to 1.00 Years Ernakulam,Idukki, Dehradun, Chennai, Vijayawada, Bhuj, Hyderabad, Chandigarh, Ranchi, Mysore 01 Apr, 2025

Dear applicant, Online data entry jobs is normal typing work. Just require typing speed 30 to 50 wpm. Our company hiring every month fresher for daily online jobs Employment Type: english writingtypingdata entry

REMOTE DATA ENTRY EXECUTIVE WORK FROM HOME
VISHWANATH ENTERPRISES 0.00 to 2.00 Years Ernakulam,Thrissur, Bangalore, Chennai, Hyderabad, Kolkata, Vishakhapatnam, Pune, Chandigarh, Ahmeda 01 Apr, 2025

Job Title: Online Data Entry Specialist We have an urgent requirement of Data Entry Operator (Work From Home) who is dedicated and serious about his work. Opportunities for career advancement a...
handwriting work from hometyping speedwriting skills

Virtual Backed office work / Part-time (Remote)
Aspect Solution 0.00 to 1.00 Years Ernakulam,Kollam, Rajahmundry, Chennai, Other Madhya Pradesh, Pondicherry, Navi Mumbai, Hubli, Other 01 Apr, 2025

Part time works Computer works Home based works For- Students, housewifes, Retired person & Job Employees.The golden opportunity you are seeking is in yourself. Job Role: Fresher /Computer Opera...
data entryexcelback office

Team Coordinator
SHARMA ENTERPRISES 4.00 to 9.00 Years Ernakulam,Idukki, Kannur, Kasargod, Kochi, Kollam, Kottayam, Kozhikode, Thrissur, Wayanad 01 Apr, 2025

We are looking for a result-driven team leader to be responsible for monitoring and supervising a team of consultants to achieve the organizations objectives and increase sales. You will be respo...
navigationanalysisconflict preventioncommunication skillsproblem solvingleadership managementmanagement reportingcontrolreportingtask completionorganizational administration

Floorman vacancy
Apex Offshore Services 0.00 to 1.00 Years Ernakulam,Idukki, Kochi, Kozhikode, Palakkad, Thrissur, Other Madhya Pradesh, Vishakhapatnam, Kakina 01 Apr, 2025

Greeting Walk-in Interview starts in Mumbai we are hiring for the position of Floormanwith a leading Oil & Gas Industry Job Responsi...
gasdrillingoffshore platformsoildiploma in drilling engineer

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

PREV
NEXT

hiring training developing new employees dot Job Openings

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering