insurance tele calling jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

insurance tele calling Job Openings

Showing 14201 - 14250 of 33806 Jobs

Hiring AR Caller

Starworth Global Solutions 1.00 to 5.00 Years Jaipur,Noida, Chennai, Gurugram, Pune, Mumbai City 01 Apr, 2025

denials

physician billing

ar calling

OPENINGS FOR AR CALLER

Starworth Global Solutions 1.00 to 4.00 Years Jaipur 01 Apr, 2025

revenue cycle management

voice process

hospital billing

ub04

QC

SAMSON SCIENTIFICS AND SURGICALS PVT LTD 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Sales Manager (Forex & Comex)

Signal Expert Global 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Cold Calling

Sales Strategies

Relationship Management

SalesMarketing Skills

Global Market Knowledge

Admission Counselor/Tele Counselor/Walk IN Counselor

Indore Institute Of Law 0.00 to 4.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Admission Counselor

Tele Counselor

Senior Python AL/ML Developer || Indore

Emorphis Technologies 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Natural language processing NLP

Equity Research Analyst

Jobsense 1.00 to 3.00 Years Indore 01 Apr, 2025

Relationship Manager

DREAMS SOLUTIONS 0.00 to 3.00 Years Indore 01 Apr, 2025

We hiring For Relationship Manager And Advisor

For -INDORE/ NOIDA/ MUMBAI

Experince-6 Month to 2 year

sales

direct marketing

demat accounts

Agency Manager - Health Insurance

Skill Sphere Placement Services Hiring For Niva Bupa Health Insurance 1.00 to 6.00 Years Indore,Ujjain, Jabalpur, Bhopal, Chhindwara, Raipur, Alwar, Ludhiana, Ambala, Raigarh 01 Apr, 2025

Profile:

Vertical :

CTC Offered :

agency channelinsurance salesgeneral insurancefield saleschannel partnershealth insuranceagency developmentbusiness development

Hr Recruiter

SHREE MAHAKAL OUTSOURCING SERVICES 0.00 to 2.00 Years Indore 01 Apr, 2025

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac

Niyukti Management Consultants 6.00 to 11.00 Years Indore,Bhopal, Dehradun, Jaipur, Noida, Karnal, Sirsa, Gurugram, Faridabad, Delhi 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company

Location:

life insurance

sales

unit manager

business development manager

deputy branch manager sourcing

development manager

sales manager

agency development manager

business manager

Hiring For Medical Biller

Divya Staffing Solution 0.00 to 4.00 Years Indore,Surat, Qatar, Ahmedabad, Guwahati, Kuwait, United Arab Emirates, Rajkot, Haripur, Pune, Mumba 01 Apr, 2025

Sales Manager

Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Indore,Ujjain, Bangalore, Chennai, Kurnool, Gurugram, South Goa, North Goa, Delhi 01 Apr, 2025

Associate Agency Development Manager

marketing

sales

Posting Insurance Sales Manager

Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Indore,Ujjain, Jabalpur, Gwalior, Bhopal, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

agency development manager

sales officer

sales executive

Relationship Manager

Veerwal Getwork Services Private Limited 1.00 to 6.00 Years Indore,Bhopal, Noida, Ghaziabad, Karnal, Faridabad, Rohtak, Delhi 01 Apr, 2025

NBFC (Housing Finanace Company)

mortgage loans

home loans

Unit Sales Manager

ICICI LOMBARD GENERAL INSURANCE CO LTD 1.00 to 2.00 Years Indore,Nashik, South Goa, Ahmednagar, North Goa, Pune, Nagpur, Other Goa 01 Apr, 2025

Sales Team Coach

ICICI LOMBARD GENERAL INSURANCE CO LTD 3.00 to 8.00 Years Indore 01 Apr, 2025

sales operationsleadership skillsoutbound salesteam handlingtelesalescall center operationstarget achievementverbal communicationsales support

Hr Executive

H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Process Associate

STRYDE CONSULTING SERVICES Fresher Hyderabad 01 Apr, 2025

icse

excellent communication

Urgent Opening for Frontline Sales Associate for Insurance Domain

SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

We are hiring for Frontline Sales Associate for Insurance Domain

SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Senior Ar Caller - Hospital Billing

AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Mumbai City 01 Apr, 2025

Experience

Location

Minimum 1 Years of experience ...
ub04cms-1500denial managementar callingmedical billingar calling medical billingus healthcareclient partnerar caller

Pre Sales Executive

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:

Experience Required:

Location: presalestele sales

AR Caller / Senior AR Caller - Denial Management
AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Experience and Skills Required

Minimum 1 Years of experience in AR Caller (Voice)

Knowledge of Physician Billing or Hospital Billing and D...
ub04us healthcaremedical billingcms-1500ar callingar calling medical billing

RELIANCE LIFE INSURANCE - SPOT OFFER - ON ROLE - HIGH CTC - PAN INDIA
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Job Role : Senior Relationship Manager, Greetings! Roles & Responsibilities,

Candidate has to work on the leads provided by the Organization.

Cand...
life insuranceagent recruitment

Insurance Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Job Summary: As a Frontline Sales Representative, you will interact directly with customers to generate leads, drive sales, and build long-term rel...
frontinsurancesaleslinedirect

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Design Intern
swifnixcom 0.00 to 4.00 Years Gwalior,Other Madhya Pradesh 01 Apr, 2025

Required Skills and Qualifications: Proficiency in design tools such as Adobe Creative Suite (Illustrator, Photoshop, InDesign) or Sketch, Figma, or similar. Strong understanding of design princ...
Adobe Creative SuiteCoral DrawHTMLCSSJavaScriptSketchFigma

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Tele Sales Executive
XIPHI INSIGHTS PRIVATE LIMITED 1.00 to 2.00 Years Gurugram 01 Apr, 2025

A Real Estate Telesales job description typically involvesgenerating leads, making outbound calls to potential clients, presenting properties, and closing sales deals, all whi...
communication skillscallinginternational

Profiles to be source-Agency Direct - in Life Insurance
ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Telecaller
THE TALENT KEEPERS 2.00 to 7.00 Years Gurugram 01 Apr, 2025

URGENT HIRING ! Profile-Telecaller Executive Company- Real Estate Location- Gurugram ROLES & RESPONSIBILITIES
customer careinbound processbpotelecallingcalling

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Required Tele Caller Dayshift
Sharda Consultancy Services 0.00 to 2.00 Years Gurugram,Delhi, Noida 01 Apr, 2025

Required Female Tele Caller for outbound domestic process.Good communication skills Salary - upto 15k working days - 6 days (Sunday off ) Shift Time - 10 AM to 7 pm Salary date...
outbound marketingdomestic bpotelesalesbposales

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Sales Manager
Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

We are looking for a motivated Associate Agency Development Manager to support the recruitment, training, and growth of agency teams. The ideal cand...
marketingsales

Freelance Recruiter and Intern
KKD Consulting Hiring For KKD 0.00 to 1.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Sonipat, Palwal, Mumbai City, Meerut 01 Apr, 2025

Job Title: Freelance Recruiter & Recruitment Intern Location: Remote Job Type: Freelance / Internship
About Us:
[Y...
callingscreening

Freshers, Exp - Sales Associates - EV Charger Manufacturer
Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Greetings from Avani Consulting We are hiring for the below opportunity: Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem. <...
sales coordinationchargerslithium-ion batteriesbattery

Openings for Life Insurance Sector- Delhi location (CTC up to 5 LPA)
ATS Infovision 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. : hidden_mobile or just a message on whatsapp with Yes to get a call back <...
direct salesinsurancecasa salesbankingfield workdirect channel saleslife insurancedirect marketing

Tele Caller
Synergy Plus Business Consulting Group 0.00 to 1.00 Years Gurugram 01 Apr, 2025

Job Title: Tele caller Location:Gurgaon Experience: 0-2...
bpolead generationcustomer relationship

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Phone Banking Officer
EBIXCASH GLOBAL SERVICES PRIVATE LIMITED 0.00 to 1.00 Years Noida 01 Apr, 2025

Payroll Company Name : - Ebixcash Global Services. www.ebixcashglobalservices.com Were hiring Male / Female Fresher and experienced candidates for Ebixcash Process ( Customer ...
tamil speakingtelugukannadatele sales excecutive

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Data Entry Operator-Work From Home-Computer Work-Typing Work Fresher (Delhi-NCR)
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, were seeking a skilled data entry operator to join our data team. In this role, youll manage essential data input tasks, such as ensuring data accura...
work from homeback officefreelancingdata entrypart timehome based data entrytypingstudentsfresher

Hiring AR Caller
Starworth Global Solutions 1.00 to 5.00 Years Gurugram,Noida, Jaipur, Chennai, Pune, Mumbai City 01 Apr, 2025

Hiring AR Caller Location:Pune,Mohali,jaipur,Noida,Gurgaon,Chennai,Trichy Work from office night shift Exp;1-5 years Ctc:max 5.5lpa All Documents must PF Mandatory Immediate Joiner to 15 ...
denialsphysician billingar calling

PREV
NEXT

insurance tele calling Job Openings

Job Description / Responsibilities:

Job Description / Responsibilities:

About Us:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers