Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

loans recovery Job Openings

Showing 4251 - 4300 of 6944 Jobs

UNDERWRITERS

PERSONAL NETWORK 1.00 to 6.00 Years Faridabad,Ghaziabad, Pune 29 Oct, 2024

UNDERWRITER - US Mortgage - Upto 10 Lakhs

hidden_mobile

Home loan sales

Tiara Consultancy Services 1.00 to 6.00 Years Delhi,Noida, Gurugram 29 Oct, 2024

Job Responsibilities

Identifying and onboarding the potential DSAs and Channel partners from open market
Build and strengthen relationships with new and e...
laphome loanssaleshousingloan

Collection Manager

HAPPY SQUARE OUTSOURCING SERVICES PRIVATE LIMITED 4.00 to 6.00 Years Delhi 29 Oct, 2024

uf0b7 Bacheloru2019s degree in any discipline uf0b7 Minimum of 2 years of experience in loan collections

preferably in personal loans

unsecured lending uf0b7 Strong interpersonal

negotiation skills with the ability to build rapport with customers uf0b7 Kn

Head - Credit

A2Zee HR SOLUTIONS 10.00 to 20.00 Years Delhi 29 Oct, 2024

Credit Strategy and Policy Development

Develop and own credit policy and performance for fleet
Develop, review, and implement comprehensive cr...
strategycreditmanagementbusiness transformation

Child Life Specialist

NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Noida, Bangalore, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 29 Oct, 2024

Debt Recovery Agent

Veerwal Getwork Services Private Limited 0.00 to 4.00 Years Delhi,Noida, Hyderabad 29 Oct, 2024

WALK-IN INTERVIEW DRIVE ALERT!!!!!!!

Relationship Officer

ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 0.00 to 3.00 Years Chennai 29 Oct, 2024

Tuesday 29^th Oct 2024 forFrontline Sales (Housing Loan, Loan against Property, Mortgage), please refer below details for same:

Positi...
home loanssecured financingmortgageaffordable housinglaphousing finance

Sales Executive
LIVE CONNECTIONS PLACEMENTS PVT LTD 0.00 to 4.00 Years Chennai,Madurai, Coimbatore, Bangalore, Hubli, Mysore 29 Oct, 2024

Urgent requirement for below requirement for NBFC - Sales Officers / Sr. Sales Officers Freshers / 6 months Exp in Mortgage / HL domain (DST only) - Education : o Freshers Graduation must o F...
home loanssales processfield salesdirect saleslap

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Database Administrator
ARYAN TECHNOLOGY 0.00 to 4.00 Years Chennai,Bangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance an...
oracleoracle streamssqlpl/sqloracle dba

Business Development Executive
Skywings Advisors Private Limited 1.00 to 6.00 Years Chennai,Karnal, Mangalore 29 Oct, 2024

Hi, We are hiring for Life Insurance. Channel: Banca - Credit Life (Insurance against loan) Job responsibilities: His /Her primary responsibility is to drive credit life Insurance Sales through...
branch bankingretail bankingbfsiinsuranceagencycross sellingcredit cardsloanscasa

Senior Sales Officer
GRAMPRO BUSINESS SERVICES PRIVATE LIMITED 1.00 to 4.00 Years Chennai,Salem, Tiruchirappalli, Coimbatore 29 Oct, 2024

ESAF Small Finance Bank is Hiring! Job Profile : Senior Officers - Auto Loans Department Vertical : Retail Assets- Branch Banking Location :Trichy, Coimbatore, Chennai, Salem Criteria: Candida...
auto loanscommercial vehicle loans

Petroleum Engineer
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 10.00 to 20.00 Years Bangalore,Chennai, Hyderabad, Palampur, Kolkata, Gurugram, North Goa, Bharuch, Samba, Ambala 29 Oct, 2024

We are looking for an analytical petroleum engineer to assist with the location of natural petroleum reservoirs and to devise the best methods of extraction. The petroleum engineers responsibilit...
petroleumengineeringoildrillingoperationsnaturaloffshoregasonshoreengineer

Casa Sales Officer
LIVE CONNECTIONS PLACEMENTS PVT LTD 0.00 to 4.00 Years Bangalore,Vijayawada 29 Oct, 2024

Relationship Manager for CASA (Current Account and Savings Account) sales: Job Opportunity: Relationship Manager - CASA Sales Or Lap and home loan Experience: 1 years We are seeking an experi...
lapcasahome loans

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi, Port Blair 29 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Child Life Specialist
NEW ERA LIFE CARE PRIVATE LIMITED 11.00 to 21.00 Years Bangalore,Chennai, Noida, Nellore, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 29 Oct, 2024

We are looking for a Child Life Specialist to join our team and help our pediatric patients have a more relaxing and effective recovery time while in our healthcare facility. Child Life Speciali...
collaborationleadershipcommunicationadvocacytherapydevelopmentpatienceemotionalservicesfamilylifeempathychildplayengaging

Database Administrator
ARYAN TECHNOLOGY 0.00 to 4.00 Years Bangalore,Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 29 Oct, 2024

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance an...
oracleoracle streamssqlpl/sqloracle dba

Relationship Officer
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 0.00 to 3.00 Years Bangalore 29 Oct, 2024

Hi Aspirants, We have walk in drive onTuesday 29th Oct 2024 for Relationship Officer. Please refer below details for same: M...
home loanshousing financefield sales

Credit Manager Auto Loans
Taggd 2.00 to 7.00 Years Ahmedabad,Indore, Ranchi, Patna 29 Oct, 2024

Hiring Credit Manager and Area Credit Manager in Auto Loans/ Vehicle Loans Domain. All India opening. Locations Ranchi, Indore, Ahmedabad, Guwahati, Andhra Pradesh, Bihar. Duties & Resp...
vehicle loanscredit controlcredit analysiscredit risk

Relationship Manager
SKILLVENTORY Hiring For Leading NBFC company 1.00 to 6.00 Years Pune,Kolkata, Surat 24 Oct, 2024

Job Responsibilities:

Should have experience in Mortgage Loan, Loan against property

Generating business fr...
lapsalesnbfc

Hotel General Manager
TEAMWORK CABLES PRIVATE LIMITED 15.00 to 25.00 Years Nagpur,Aurangabad, Nanded, Ratnagiri, Ahmednagar, Sangli, Comoros, Bangladesh, Bangalore, Chennai, P 24 Oct, 2024

HOTEL GENERAL MANAGER:

Oversee the operations functions of the ...
hotel housekeepinghotel bookingreservationshotel managementhotel operations

Debt Recovery Agent
Veerwal Getwork Services Private Limited 0.00 to 4.00 Years Noida,Delhi, Hyderabad 24 Oct, 2024

Dear Applicants, WALK-IN INTERVIEW DRIVE ALERT!!!!!!! Currently we are hiring for Debt Recovery Agent (Tele collection Officer) for DEBT MANAGEMENT COMPANY FOR Delhi/Mumbai/Hyd...
recoverydracollectiondebt recoverytelecollectiondebt recovery agentfreshertele collectionrecovery officer

Home loan sales
Tiara Consultancy Services 1.00 to 6.00 Years Noida,Delhi, Gurugram 24 Oct, 2024

Job Responsibilities -

Identifying and onboarding the potential DSAs and Channel partners from open market

Build and strengthen relationships with new and e...
laphome loanssaleshousingloan

Tele Relationship Manager- HL Digital
SAKASH RESOURCE MANAGEMENT PRIVATE LIMITED 2.00 to 7.00 Years Kalyan,Thane, Dombivali 24 Oct, 2024

Tele Relationship Manager- HL Digital We are looking for motivated sales professionals to join our HL Digital team, reporting to the Lead - HL Digital. This role involves engag...
home loanshousing finance

Financial Service Associate
Skywings Advisors Private Limited 0.00 to 4.00 Years Navi Mumbai 24 Oct, 2024

Roles & Responsibilities:

Contact businesses and private individuals by telephone to promote services

Should be able to explain the product and its benefits ...
loan salestele salescustomer servicetelesalestelemarketingtelecom salessalespersonal loans

Nurse Anesthetist
SPENTO PAPERS (INDIA) LLP 10.00 to 0.00 Years Hyderabad,Ethiopia, Bangladesh, South Africa, Asansol, Bangalore, Noida, Albania, Imphal, Kolkata, L 24 Oct, 2024

We are looking for a detail-oriented Nurse Anesthetist to join our team and assist our medical staff and patients. Nurse Anesthetists are responsible for administering anesthesia, and they must a...
anesthesiacaremanagementpaincrnaairwayresuscitationinformedpatientspatient

Debt Recovery Agent
Veerwal Getwork Services Private Limited 0.00 to 4.00 Years Hyderabad,Noida, Delhi 24 Oct, 2024

Dear Applicants, WALK-IN INTERVIEW DRIVE ALERT!!!!!!! Currently we are hiring for Debt Recovery Agent (Tele collection Officer) for DEBT MANAGEMENT COMPANY FOR Delhi/Mumbai/Hyd...
recoverydracollectiondebt recoverytelecollectiondebt recovery agentfreshertele collectionrecovery officer

Home loan sales
Tiara Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Noida 24 Oct, 2024

Job Responsibilities -

Identifying and onboarding the potential DSAs and Channel partners from open market

Build and strengthen relationships with new and e...
laphome loanssaleshousingloan

Team Leader
Goodwill Associates 1.00 to 5.00 Years Delhi 24 Oct, 2024

Required Candidate Profile: Eligibility Criteria

Should have handled minimum of 10- 15 team members. 2.You should have good knowledge in System and MIS managem...
decision-makingcollections strategydata managementconflict resolutionteam managementdelegate managementmis updationstrategic thinkingteam building

Sales Executive
LIVE CONNECTIONS PLACEMENTS PVT LTD 0.00 to 4.00 Years Bangalore,Mysore, Hubli, Madurai, Chennai, Coimbatore 24 Oct, 2024

Urgent requirement for below requirement for NBFC - Sales Officers / Sr. Sales Officers Freshers / 6 months Exp in Mortgage / HL domain (DST only) - Education : o Freshers Graduation must o F...
home loanssales processfield salesdirect saleslap

Collection Manager
SKILLVENTORY 3.00 to 8.00 Years Ahmedabad,Chennai, Bhopal 24 Oct, 2024

Recover Dues from customer and Report regarding strategies of collection to manager Plan && execute the collection strategy for the month/ quarter to ensure regional goals are over achieved. ...
collectionsrecovery collectionsdebt recoverynpa

Collection Manager
IQuest Management Consultants Pvt Ltd Hiring For Collection Manager 5.00 to 10.00 Years Ahmedabad,Chennai, Mumbai City, Delhi 24 Oct, 2024

Hello, Greetings! I am a Recruitment Consultant specialized in hiring for all the major and renowned IT and Non-IT companies across global. PFB, description for your reference. If youre interes...
retailcollection manager

Tele Collection Executive
AASAANJOBS PRIVATE LIMITED Hiring For AASAANJOBS PRIVATE LIMITED 0.00 to 4.00 Years Noida 22 Oct, 2024

Urgent hiring for Tele Collection Executive Location:- Sec-62, Noida Salary:- Up to 25k ESI/PF Incentives(fixed salary depends on the interview) Job Description Roles and Responsibilities:- W...
recovery collectionscustomer supporttelesalesvoice processcollections salesrecoverybanking sales

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Noida,Delhi, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Port Blair 22 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Shriram Finance hiring Trainee CS (company secretary) for Internship-Articleship
SHRIRAM FINANCE LIMITED 0.00 to 3.00 Years Navi Mumbai,Mumbai City, Thane 22 Oct, 2024

Dear Candidates, Shriram Finance is the countrys biggest retail NBFC offering credit solutions for commercial vehicles, two-wheeler loa...
secretarial activitiesdrafting

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Delhi, Port Blair 22 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Home Loan Executive
AVA Infotech 1.00 to 6.00 Years Gurugram,Delhi, Noida, Dehradun, Chandigarh 22 Oct, 2024

Job Description

Responsible for ensuring the achievement of sales targets(LAP).

Responsible for generating prospective sales lead.

Responsible for ...
loan salesmortgagemortgage loanshome loans

Home Loan Counsellor
O3Hire Hiring For o3hire 1.00 to 6.00 Years Gurugram,Delhi 22 Oct, 2024

KeyResponsibilities:
counsellinghome loansclient acquisitiondirect salesloan processingsalesclient relationship management

Collection Manager
IQuest Management Consultants Pvt Ltd Hiring For Collection Manager 5.00 to 10.00 Years Delhi,Chennai, Mumbai City, Ahmedabad 22 Oct, 2024

Hello, Greetings! I am a Recruitment Consultant specialized in hiring for all the major and renowned IT and Non-IT companies across global. PFB, description for your reference. If youre interes...
retailcollection manager

Home Loan Executive
AVA Infotech 1.00 to 6.00 Years Delhi,Noida, Dehradun, Gurugram, Chandigarh 22 Oct, 2024

Job Description

Responsible for ensuring the achievement of sales targets(LAP).

Responsible for generating prospective sales lead.

Responsible for ...
loan salesmortgagemortgage loanshome loans

Home Loan Counsellor
O3Hire Hiring For o3hire 1.00 to 6.00 Years Delhi,Gurugram 22 Oct, 2024

KeyResponsibilities:
counsellinghome loansclient acquisitiondirect salesloan processingsalesclient relationship management

Lease Administrator
GALLAGHER AND MOHAN PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Port Blair 22 Oct, 2024

Lease Administrator
What we are and what we do:- Gallagher & Mohan works exclusively within the real estate industry. Our mission is to provide financial analysis, mark...
lease administrationadministration

Food & Beverage Executive
KINAL GLOBAL CARE PRIVATE LIMITED 10.00 to 20.00 Years Chandigarh,Singapore, Surat, Oman, South America, Saudi Arabia, Senegal, Uganda, Tanzania, Rajahmund 22 Oct, 2024

Maintain cleanliness of work areas, china, glass, etc, throughout the day.

Complete closing duties, including restocking items, turning off lights, etc Present physical and a...
alcoholic beveragesguest recoverymenu costingsupervisory skillsbanquet operationsbeverage industryservicehospitalitysafety training

Enterprise Resources Planning Consultant
Nalanda Educational Institutions 4.00 to 8.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

ERP Consultant - MyClassboard Position Overview: The ERP System Administrator - MyClassboard will be responsible for the daily management, configuration, and support of the MyClassboard ERP syst...
System configurationUser supportTrainingData managementProcess improvementComplianceSecurityProject managementInterpersonal skillsERP system administrationReportinganalyticsProblemsolving

Business Development Executive
Sadhya Overseas Educational Services 1.00 to 5.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

The job role involves Cold calls (Tele calling) reg Personal loans, Study loans & Home loans to the leads provided by the management and generate the prospective on daily basis. The prospective ...
Business developmentExcelCustomer serviceCold calls

Regional Head - Home Loan
squareyards 3.00 to 7.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

Who We Are Urban Money (Square Capital Advisory Services Pvt. Ltd) is a Corporate & International DSA with a workforce of 2000 employees worldwide. It offers a comprehensive, integrated menu of ...
LeadershipCustomer servicePresentationNegotiation skillsMS Office WordOutlookExcelStrong communicationPlanningorganizing skills

L3 Datacenter Network Engineer
Pi DATACENTERS 2.00 to 8.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

Were seeking a seasoned Data Center Network Engineer L3 to join our growing IT team! In this critical role, youll be responsible for designing, implementing, managing, and optimizing our data cen...
Routing protocolsNetwork securityNetworking technologiesSwitching protocolsSDNMicrosegmentationNetwork automation tools

Assistant Collection Manager
Padmasai Finance Private Limited 5.00 to 9.00 Years Vijayawada,Other Andhra Pradesh 19 Oct, 2024

Job description Position:Assitant Manager Collection Age should be below Age 35Years. Track the upcoming EMIs due closely and ensure awareness calling on the portfolio wherever required. overs...
Time managementCollections experienceAuto Finance industryBanking industryVehicle loans disbursementcollections

Credit Manager
Aanya Placement Services 2.00 to 7.00 Years Vishakhapatnam,Tirupati, Other Andhra Pradesh, Other Tamil Nadu, Other Odisha, Other Kerala, Pondich 19 Oct, 2024

Job brief We are looking for a Credit Manager to oversee our companys lending process, from evaluating clients creditworthiness to approving or rejecting loan requests. Credit Manager respon...
loan operationscommunication skillsrisk managementcustomer relationshipcredit analysis

Food & Beverage Executive
KINAL GLOBAL CARE PRIVATE LIMITED 10.00 to 20.00 Years Vishakhapatnam,Kakinada, Rajahmundry, Singapore, Surat, Oman, South America, Saudi Arabia, Senegal, 19 Oct, 2024

Maintain cleanliness of work areas, china, glass, etc, throughout the day.

Complete closing duties, including restocking items, turning off lights, etc Present physical and a...
alcoholic beveragesguest recoverymenu costingsupervisory skillsbanquet operationsbeverage industryservicehospitalitysafety training

PREV
NEXT

loans recovery Jobs

loans recovery Job Openings

Credit Strategy and Policy Development

Lease Administrator

Responsibilities As a database administrator, youll need to: establish the needs of users and monitor user access and security monitor performance an... oracleoracle streamssqlpl/sqloracle dba

Lease Administrator

Responsibilities As a database administrator, youll need to: establish the needs of users and monitor user access and security monitor performance an... oracleoracle streamssqlpl/sqloracle dba

HOTEL GENERAL MANAGER: Oversee the operations functions of the ... hotel housekeepinghotel bookingreservationshotel managementhotel operations

Lease Administrator

Lease Administrator

Lease Administrator

Job brief We are looking for a Credit Manager to oversee our companys lending process, from evaluating clients creditworthiness to approving or rejecting loan requests. Credit Manager respon... loan operationscommunication skillsrisk managementcustomer relationshipcredit analysis

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance an...
oracleoracle streamssqlpl/sqloracle dba

Responsibilities As a database administrator, youll need to:

establish the needs of users and monitor user access and security

monitor performance an...
oracleoracle streamssqlpl/sqloracle dba

HOTEL GENERAL MANAGER:

Oversee the operations functions of the ...
hotel housekeepinghotel bookingreservationshotel managementhotel operations

Job brief We are looking for a Credit Manager to oversee our companys lending process, from evaluating clients creditworthiness to approving or rejecting loan requests. Credit Manager respon...
loan operationscommunication skillsrisk managementcustomer relationshipcredit analysis