Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Candidate should have excellent communication and language skills. He/ she should have a good exposure to and understanding of Design & Advertising and should be able to work under pressure. Should be...
mediasales spaceselling digitalmedia mediaagencies clientservicing directmarketing revenuegeneration negotiationskills campaignmanagement sales design selling marketing servicing management advertising egotURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopURGENT OPENING will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp 100-200 Agents To meet ...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopEnsuring compliance with regulations set by medicines,healthcare products regulatory agency namely(AYUSH, FSSAI, DRUG & COSMETIC ACT) Keeping up to date with changes in regulatory legislation&guidelin...
documentation fda validation legal communicationskills set agency filling healthcare compliance regulations communication MarketingAgency DigitalAgency MediaAgencies CreativeAgency egulat yaffairs regulat AgeContent Manager If you are interested to be part of a dynamic social startup that works towards serving the common good and will not just change India for the better but also make giving back more inc...
contentmanagement editing marketing websiteproduction writing managingmediarelations socialmedia onlinemedia mediatrends brandbuilding pressreleases mediaagencies randingidentitymarketing digitalagenJob Name : Digital Marketing Executive Job Role : Marketing Executive Industry : IT/ Software Job Location : Indore (MadhyaPradesh) Experience : 1 to 3 Year Salary : Best in the industry Skills: SEO, ...
googleanalytics seo marketing websiteproduction advertising adobecreativesuite adserving socialmedia webanalytics hrconsulting ds mediaagencies onlinemarketing anizationalwritingskills googleadwJOB DESCRIPTION: Greetings from Abbott! About Us: Abbott is a global healthcare leader that helps people live more fully at all stages of life. Our portfolio of life-changing technologi...
marketing advertising brandmanagement sales atl newproductideas mediaagencies spectrummanagement randingidentitymarketingLiaise with the creative agency team to develop media strategies and campaigns. Liaise with the creative team to create and manage media products like magazines. Make decisions on the best form of...
creativeagency grasp agency writing research literacy magazines campaigns analytical newspapers MediaAgencies MarketingAgency DigitalAgency AdvertisingAgency CreativeBriefs CreativeServices nf InteractiveAdCandidate should be from Life Insurance & Agency Experience of 4 to 5 years . He will recruit a team of Agency Partners and Agency Partners will recruit Insurance Agents and Advisors . Only Local cand...
sales businessdevelopment marketing customerrelations insurance lifeinsurance sun agency MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements dveProven experience as Digital Marketing Executive or similar role. Excellent understanding of digital marketing concepts and best practices. Experience with B2C social media, Google Adwords and email c...
googleanalytics seo marketing websiteproduction advertising adserving socialmedia webanalytics ds mediaagencies onlinemarketing creativecontent digitalmarketing contentmarketing oogleadw imageoptimiZ2 Placement & Security Agency Pvt. Limited Job description Very Urgent opening for position of Nurse in Pata (Kanpur). Kindly send to me your resume for the post of Nurse. Should be ANM/ GNM or B...
gnm mmu agency resume security placement MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership AgencyDevelopment AgencyAgreements AdvertisingCollateral gencyCo dination CertifiedProfHe/She will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp & 100-200 Agents To meet the ye...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopHe/She will be responsible for productivity of the Unit / Branch for recruitment , retention & development of Managers & Agents. Needs to Manage Team of 20 salaried Emp & 100-200 Agents To meet the ye...
sales marketing businessdevelopment banking insurance lifeinsurance emp agency benefits retention incentives recruitment MarketingAgency DigitalAgency MediaAgencies CreativeAgency AgencyLeadership gencyDevelopReceptionist Job Vacancy | Advertising Agency Jobs in Mumbai | Riyo Ad Agency Advertising Agency for all leading Newspapers & Magazines. +91 22 67707001 / 67707002 info@riyoadvertising.com Gradua...
advertisingagencyreceptionistdutiescommunicationskillsbasicfilingagencyschedulecalendarscollatingnewspapersadvertisingcommunicationMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencygencyLeaBring your passion and talent to our stage and share our PepsiCo vision to Be the Global Leader in Convenient Foods and Beverages by Winning with Purpose. Winning with Purpose reflects our ambition to...
marketingmixmodelingdigitalmediamarketingmixbusinessunitsmediaagenciesteamleadershipthinkingskillsenglishlanguageapplicationsdigitalmarketingchangemanagementbusinessservicesriticalthiShipping Experience is Mandatory Post Graduate 6 years of experience in Domain Required Skills: Line or Agency part of the business Process specialist In-depth knowledge of transportation Inter...
insuranceproductdevelopmentprojectmanagementagencyshippingMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencyAgencyLeadershipAgencyDevelopmentAgencyAgreementscustomersuppAdvertisinPlan and monitor the ongoing company presence on social media (Twitter, Facebook etc. ) -Launch optimized online adverts through Google Adwords, Facebook etc. to increase company and brand awareness...
googleanalyticsseomarketingadvertisingsocialmediawebanalyticsonlinemarketingdigitalmarketingcontentmarketingebsiteproductiongoogleadwmediaagenciesbrandawarenessimageoptimizationproce
Here is a chance to work for a Consumer Electronics Brand, where you get to deal with some of the best channels and work with some excellent experienced minds. Read on. Started in 2015, this lifestyl...
marketingsalescustomerrelationsbusinessdevelopmentadvertisingsocialmediawebanalyticsmediaagenciesonlinemarketingdirectmarketingdigitalmarketingcontentmarketingimageoptimizationoogleadwHere is a chance to work for a Consumer Electronics Brand, where you get to deal with some of the best channels and work with some excellent experienced minds. Read on. Started in 2015, this lifestyl...
marketingsalescustomerrelationsbusinessdevelopmentadvertisingsocialmediawebanalyticsmediaagenciesonlinemarketingdirectmarketingdigitalmarketingcontentmarketingimageoptimizationoogleadwAmazon Prime Video is changing the way people watch movies and TV shows, offering multiple ways to instantly stream and watch videos. Our mission is to build the widest selection of digital video cont...
seomarketingadvertisingigitalvideosocialmediasocialmediamarketingbrandpositioningmediastrategymediamarketingmediaagenciescustomerservicetoneofvoicepivottablesdigitalcontentDearCandidates Please note our Client Pro Healthcare Nursing Agency is looking for Indian Nurses in Qatar. About Pro-Health Care. They Provide Nurses to Hospitals & Poly Clinics. Package Work Hours:...
nursingbenefitsbasicoxygenagencyhospitalstransportationhealthcaresurgerygencycoordinationdigitalagencycreativeagencynursingeducationagencydevelopmentpatientcaremediaagenciesmarketingagencyagencyleadershipagencyagreementsadvertisingcollaWe are looking for creative souls who eat , sleep and breathe design , imagination is in their genes and making beautiful designs in their DNA. Designing new concepts around which we can develop con...
marketinginternationalmarketingbusinessdevelopmentcommoditiesanalysissocialmedianewconceptsmediaagenciesmarketingmaterialspicsdesignwritersmaterialsFacebookBloggingPressReleasesompetitJob Name : Digital Marketing Executive Job Role : Marketing Executive Industry : IT/ Software Job Location : Indore (MadhyaPradesh) Experience : 1 to 3 Year Salary : Best in the industry Skills: SEO, ...
googleanalyticsseomarketingadvertisingadobecreativesuiteadservingsocialmediawebanalyticshrconsultingcontentwritingebsiteproductionganizationalwritingskillsgoogleadwmediaagencies
Responsible for selling i- Media offerings, i.e audio Advertisement sales, BTL and Rural activation activities. Achieving targets month on month Acquiring new corporate clients directly or through L...
btlsalesbuyingsellingadsalesmediasalesmediaplanningplanningactivationmediaagencies- - - Exp. of minimum 2 years in advertising agency is must. - - - candidate should possess good visualization power and having great hand on Corel , Photoshop , Adobe illustrator.,...
advertisingadobephotoshopdesignbrochuresphotoshopadvertisingagencyadobeagencyvisualizationMarketingAgencyDigitalAgencyMediaAgenciesCreativeAgencyAgencyLeadershipAgencyDevelopmentAgencyAgr
Req ID: 56367 L&A Insurance Agency Management Consultant to join our team in Bangalore, Karn taka (IN- KA), India (IN). Provide system/ domain leadership on the ACE - Agency Management Transformati...
strategymarketingsalesconsultingresearchinsuranceagencymanagementagencymanagementmanagementconsultingaceagencyinsurancemanagementleadershipMarketingAgencyDigitalAgencyMediaAgenciesransfmationGroupM is the world s largest media investment company and are a part of WPP. In fact, we are responsible for one in every three ads you see globally. We are currently looking for a Business Group Hea...
buyingmarketingewagecustomerrelationsgoogleadwordscontentcreationmobiledatasearchenginebrandmanagementbidmanagementconversionratemediaagenciesmediaplanningwebanalyticsdigitalmediaExec / Sr. Exec - Health Agency Channel ( West ) Job Summary Agency Sales / Recruit agents / Generate Business Job Details Location Pune, Pune(10 Openings)+ 5 more Shift Timings 9:30 pm - 6:30 ...
agencydvertisingcollateralagencycoordinationcreativeagencymarketingagencyagencychannelagencyagreementsagencyleadershipdigitalagencymediaagenciesagencydevelopmentJob Name: Assistant Zonal Sales Manager Job Role: Sales Manager Job Location: Udaipur / Jodhpur / Jaipur Industry: Media / Advertisement Experience: 5 - 8 Year Salary: Best in the industry Education :...
marketingsalesnetworkingretailusinessdevelopmentmediaplanningsalesplanregionalsaleshrconsultingidentifyingtrendscustomerserviceservicestandardsmediaagenciescorporateliaisontradepromotionsThere is urgent requirement for Branding & Communication coordinator for MPSSDEGB project. Please ensure following basic requirement: 1. Post Graduate degree diploma in Mass communication from a reput...
adobephotoshopsocialmediacommunicationadobephotoshoprawprintrunningcampaignssocialissuesmediaagencies
We are a home health agency with a census of ~120 patients and have a staff of 60 employees (FT and PT). When a patient is referred to our agency, one of our nurses evaluates the patient and decides t...
tecplotcomsolmpiumericalsimulationdigitalagencyvisitagencyschedulefluiddynamicsagencydevelopmentparaviewparallelcomputingcensusmarketingagencymediaagencieshighperformancecomputingagencyagreementsagencyleadershipopenmpcreativeagencyJob Description Job Description Team Member Transaction Advisory Functional Domain Insolvency & Bankruptcy Advisory Services We currently are seeking qualified candidates in the Insolvency & Bankr...
tdsincometaxfilingaccountstaxriskmanagementcommunicationskillssapallyerpmediaagenciestechnicalskillsrecoverystrategiesfinancialjustificationDesignation : Assistant Zonal Sales Manager Plant :Rajasthan Department : Sales & Marketing Location : Jodhpur, Udaipur and Jaipur Responsible for selling Media offerings Achieving targets month o...
salesmarketingbusinessdevelopmentretailmediasalesmediaplanningmarketresearchetwkingprintmediasalesstrategymediaagencieselectronicmediaateliaisoncustomerprofilingeducationalqualificaJob Name : Digital Marketing Executive Job Role : Marketing Executive Industry : IT/ Software Job Location : Indore (MadhyaPradesh) Experience : 1 to 3 Year Salary : Best in the industry Skills: SEO, ...
googleanalyticsseomarketingadvertisingadobecreativesuiteadservingsocialmediawebanalyticshrconsultingcontentwritingebsiteproductionganizationalwritingskillsgoogleadwmediaagencies* The strategic intent of the role is to lead, manage and execute the end-to-end marketing and digital agenda from the CoE Centre of Excellence set up in Chennai for EMEA markets Our ideal candidate...
coeapacemeaidealstrategymarketingagendacontrolbusinessfranchisecampaignsleadershipmediaagencies© 2019 Hireejobs All Rights Reserved