plant biology jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

plant biology Job Openings

Showing 251 - 300 of 7083 Jobs

Project Sales - bangalore,mumbai

Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Bangalore, HyderabadHyderabad, Vijayawada, Mumbai City 28 Jul, 2026

Description:

sales

architet

project

Chemical Engineer

SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, QatarQatar, Port Blair, Noida, Chennai, Sri Lanka, United Arab Emirates, Hyderabad, Kolka 28 Jul, 2026

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Operations Manager - Cosmetics

Dhruv Corporate (HR) Solutions Pvt Ltd 1.00 to 10.00 Years Ahmedabad 28 Jul, 2026

production managementbeauty industrybeautyoperations managementpersonal carecosmeticsmanufacturing operations

Maintenance Head

JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ahmedabad, NashikNashik, Bhubaneswar, Dehradun, Lucknow, Kolkata, Jamshedpur, Pune, Delhi, Bhopal 28 Jul, 2026

Maintenance Head

machine maintenance

mechanical maintenance

maintenance

utility maintenance

plant maintenance

Plant Finance head, Ahemdabad (Mehemdabad)

Job Search Hiring For Pharmaceutical Manufacturing Plant 1.00 to 10.00 Years Ahmedabad 28 Jul, 2026

Job Title:

Location:

Reporting To:

Experience: treasurybudgetingmisgovernanceforecastingbusiness partneringcontrolsmanufacturing finance

HVAC Service Technician
Ikamate HR India Pvt Ltd 1.00 to 10.00 Years Vijayawada 22 Jul, 2026

Job Opening Field Service Technician Designation: Field Service Technician Industry: Cold Storage / HVAC / Chiller Plant / Refrigeration Experience Required: Minimum 1 Year ______________ ...
hvac maintenancehvac

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Vijayawada, GunturGuntur, Nellore, Vishakhapatnam, Bangalore, Chennai, Hyderabad, Pune, Mumbai City, 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Mechanical Engineer Commissioning
UNInternational Hiring For Samsung 1.00 to 10.00 Years Vishakhapatnam, HyderabadHyderabad, Bhubaneswar, Cuttack, Bangalore, Chennai, Odisha, Thrissur, Jhar 22 Jul, 2026

Mechanical Engineer inCommissioning candidate must have experince inCommissioning andCombined cycle power plant or Cogeneration power plant.andcandidates who have hands-on and reliable experience...
site commissioningcommissioning engineers

Medical Coding for Biotechnology engineer,Bsc Biotech,Msc Biotech
ACHIEVERS SPOT Hiring For MEDICAL CODING 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Thanjavur, Tamil Nadu, Vellore, Sivakasi, Theni, Namakkal, Coim 22 Jul, 2026

Ct Us: HR Shanmuga priya hidden_mobile
DESCRIPTION
Medical Coding is the fastest-grow...
nursingbiotechnologypharmacymedical codingbiomedical engineeringbotanyzoologybsc biotechbiotech engineer

Food Science & Processing
AYURSMITH WELLNESS (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Tirupati, ChennaiChennai, Hyderabad, Kurnool, Qatar, Bangalore, Kuwait, Noida, Philippines, United A 22 Jul, 2026

A Food Science & Processing professional culinarytrialssupporttechnicalspecificationsdevelopmentmanagementsafetyfoodprojectpilotplantproduct

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Safety Supervisor & Safety officer
A-ONE STAFFING 1.00 to 10.00 Years Ranchi, JamshedpurJamshedpur, Bhubaneswar, Odisha 22 Jul, 2026

Urgent Requirement Post - Safety Supervisor & Safety officer Exp- Fresher Experience Both Salary - 20000 to 30000 Location - Bhubaneswar, Lanjigarh, Jamshedpur, Ranch...
safety managementsafety auditsafety trainingsafety officer activitiessafety inspectionsafety engineeringsafety analysissafety implementation

Chief Security Officer
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ranchi, PatnaPatna, Bhubaneswar, Indore, Lucknow, Hyderabad, Navi Mumbai, Delhi, Bhopal 22 Jul, 2026

Chief Security Officer Position Summary We are looking for a highly disciplined and dynamic Chief Security Officer (CSO) to lead the end-to-end security operations. The incumbe...
security managementarmy retiredairforceindustrial securityvigilancedefencemilitary

Senior Accounts Executive
JobItUs 1.00 to 10.00 Years Raipur 22 Jul, 2026

A Senior Accounts Executive for an engineering or manufacturing plant oversees daily financial operations, manages plant-specific costs, and ensures statutory compliance. They handle payroll, reco...
Cost AccountingBudgetingPayablesReceivablesStatutory ComplianceTax ComplianceFinancial ReportingAuditingInventory Management

Plant Maintenance Head
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NagpurNagpur, Bhillai, Raigarh, Nashik, Bhubaneswar, Sonbhadra, Hyderabad, Jamshedpur, Durga 22 Jul, 2026

Plant Maintenance Head - 1. Preventive & Predictive Maintenance i. Develop and implement maintenance plans for casting machines, rolling mills, furnaces, conv...
maintenancegreenfield projectcold rolling millsteel plant

Chemical Engineer
Khanha Traders 1.00 to 10.00 Years Raipur, NagpurNagpur, Durg, Gorakhpur, Chennai, Halol, Vadodara, Delhi, Meerut, Ahmedabad 22 Jul, 2026

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
chemical industryenvironmental engineeringchemical productionchemical engineeringfluid mechanicslab testing

Chemical Process Engineer
Khanha Traders 1.00 to 10.00 Years Raipur, NagpurNagpur, Gorakhpur, Vijayawada, Lucknow, Ranchi, Vadodara, Delhi, Meerut, Ahmedabad 22 Jul, 2026

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
environmental engineeringchemical productionfluid mechanicschemical analysischemical engineeringchemical industry

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Raipur, NoidaNoida, Indore, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

Manager / Senior Manager - Projects (Civil)
HR JOBS CONSULTANCY 1.00 to 10.00 Years Noida, MeerutMeerut, Gorakhpur, Kanpur, Hyderabad, Gurugram, Pune, Bhopal, Haridwar, Patna 22 Jul, 2026

Manager / Senior Manager - Projects (Civil) Key Responsibilities: Civil Projects Management: - Assess civil maintenance requirements across all plant locations and propose ...
project managementproject execution

Plant Director Metals Manufacturing
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, BangaloreBangalore, Mandya, Belgaum, Kochi, Ernakulam, Kottayam, Kollam, Thiruvanananthap 22 Jul, 2026

We are seeking an experienced Plant Director to lead large-scale aluminum manufacturing operations. The role is responsible for overseeing productio...
lean manufacturingheavy industryoperational leadership

Machine Operator
AI MZ-Tech Consultant 1.00 to 10.00 Years Mangalore, KolarKolar, Bangalore, Davanagere, Dharwad, Bellary, Bidar, Gulbarga, Belgaum, Hubli 22 Jul, 2026

Machine Operator
Machine operators mainly work with heavy machinery. They assist with the installation of their equipment and help maintain it by performing periodic tests and repairs. L...
machine buildingmachining processmachine toolsmachine learningmachiningmachine designmachine shopmachine maintenancemacintosh

Manager / Senior Manager - Projects (Civil)
HR JOBS CONSULTANCY 1.00 to 10.00 Years Meerut, NoidaNoida, Gorakhpur, Kanpur, Hyderabad, Gurugram, Pune, Bhopal, Haridwar, Patna 22 Jul, 2026

Manager / Senior Manager - Projects (Civil) Key Responsibilities: Civil Projects Management: - Assess civil maintenance requirements across all plant locations and propose ...
project managementproject execution

Chemical Process Engineer
Khanha Traders 1.00 to 10.00 Years Meerut, LucknowLucknow, Delhi, Gorakhpur, Raipur, Vijayawada, Ranchi, Vadodara, Nagpur, Ahmedabad 22 Jul, 2026

We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry knowledge and a talent for process optimization. The chemical engineer will work in the office...
environmental engineeringchemical productionfluid mechanicschemical analysischemical engineeringchemical industry

for Optometry & Genetics
ACHIEVERS SPOT Hiring For medical coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Erode, Coimbatore, Chennai, Salem, Kanyakumari, Nagapattinam, Theni, Cu 22 Jul, 2026

The Optometry & Genetics Specialist is responsible for integrating advanced eye care with genetic science to support the diagnosis, evaluation, and management of inherited and acquired ocular con...
biologybiotechnologychemistryoptometrybiochemistrybiomedicalgenetics

Chemical Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Qatar, Port Blair, Bangalore, Noida, Chennai, Sri Lanka, United Arab Emirates 22 Jul, 2026

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

for Optometry & Genetics
ACHIEVERS SPOT Hiring For medical coding 1.00 to 10.00 Years Madurai, ThanjavurThanjavur, Erode, Coimbatore, Chennai, Salem, Kanyakumari, Nagapattinam, Theni, Cu 22 Jul, 2026

The Optometry & Genetics Specialist is responsible for integrating advanced eye care with genetic science to support the diagnosis, evaluation, and management of inherited and acquired ocular con...
biologybiotechnologychemistryoptometrybiochemistrybiomedicalgenetics

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Chemical Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Qatar, Port Blair, Bangalore, Noida, Chennai, Sri Lanka, United Arab Emirates 22 Jul, 2026

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Plant Director Metals Manufacturing
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Kochi, KottayamKottayam, Kollam, Ernakulam, Thiruvanananthapuram, Thiruvananthapuram, Bangalore, Man 22 Jul, 2026

We are seeking an experienced Plant Director to lead large-scale aluminum manufacturing operations. The role is responsible for overseeing productio...
lean manufacturingheavy industryoperational leadership

Plant Head - Automobile Manufacturing
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, BangaloreBangalore, Cuttack, Noida, Chennai, Gurugram, Navi Mumbai, Pune, Bawal, Hoshiarpur 22 Jul, 2026

Plant Head - Automobile Manufacturing Key Responsibilities: Leadership & Management: The role involves driving operational excellence, improving productivity,...
plant managementplant layoutplant machineryppcplant operationsproduction planningsupply chain managementmulti-plant operationsfactory management

General Manager - Plant Operations & Administration
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Indore, NoidaNoida, Raipur, Hyderabad, Kolkata, Pune, Chakan, Bawal, Ankleshwar, Solan 22 Jul, 2026

General Manager - Plant Operations & Administration Job description Responsible for general administration of the Plant Liaising with external government bodi...
plant operationsprocess managementproduction managementliaisoningppccommercial operations

ERW Quality Manager
TALENT MAX HR & MANGAGEMENT CONSULTANT 1.00 to 10.00 Years Indore 22 Jul, 2026

ERW Quality Manager
Company: Indipower Steel Works Private Limited Location: Dewas, Madhya Pradesh Job Type: Full-Time Experienc...
tubeppappfmeaspcsteel plantmsaquality management systemquality managerautomotive steel

Trainee Chemist
SVL Manpower Solutions Pvt Ltd 1.00 to 10.00 Years Hyderabad 22 Jul, 2026

Job Description Company: Aurore Life Sciences Pvt. Ltd. Location: Jeedimetla, Hyderabad, Telangana Department: API Production / Bulk Drug Manufacturing Posit...
cmo managementproductionapi manufacturingtrainee analyst

Mechanical Engineer Commissioning
UNInternational Hiring For Samsung 1.00 to 10.00 Years Hyderabad, BhubaneswarBhubaneswar, Cuttack, Bangalore, Chennai, Odisha, Vishakhapatnam, Thrissur, Jh 22 Jul, 2026

Mechanical Engineer inCommissioning candidate must have experince inCommissioning andCombined cycle power plant or Cogeneration power plant.andcandidates who have hands-on and reliable experience...
site commissioningcommissioning engineers

Urgent Openings- Medical Coding Freshers(BAMS,BHMS,BUMS,BSMS,BDS,BNYS)
ISKILLS SOLUTIONS 1.00 to 10.00 Years Guntur, ChennaiChennai, Hyderabad, Nellore, Vijayawada, Vishakhapatnam, Bangalore, Pune, Mumbai City 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
biotechnologybiomedical engineeringcardiologyphysiotherapyoptometrymicrobiologyradiologynuclear medicine technologycardio pulmonary perfusion care technology

Site Engineer
Roche International 1.00 to 10.00 Years Guntur, ChennaiChennai, Guntakal, Anantpur, Bangalore, Noida, Pune, Mumbai City, Delhi, AndamanNicob 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Admin Head
DAIRY CRAFT (INDIA) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, Uttar Pradesh 22 Jul, 2026

Roles and Responsibilities:

Coordinate and supervise performance of tasks

Prepare routine work activity reports

Prepare routine correspondence with...
emailattendance managementissue resolutionexcel sheetadministrationleave management

Mechanical Engineer Commissioning
UNInternational Hiring For Samsung 1.00 to 10.00 Years Thrissur, ThiruvananthapuramThiruvananthapuram, Bhubaneswar, Cuttack, Bangalore, Chennai, Odisha, Hy 22 Jul, 2026

Mechanical Engineer inCommissioning candidate must have experince inCommissioning andCombined cycle power plant or Cogeneration power plant.andcandidates who have hands-on and reliable experience...
site commissioningcommissioning engineers

Plant Director Metals Manufacturing
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Ernakulam, KochiKochi, Kollam, Kottayam, Thiruvanananthapuram, Thiruvananthapuram, Bangalore, Mandya 22 Jul, 2026

We are seeking an experienced Plant Director to lead large-scale aluminum manufacturing operations. The role is responsible for overseeing productio...
lean manufacturingheavy industryoperational leadership

Medical Coding Executive
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, ThanjavurThanjavur, Madurai, Tiruchirappalli, Chennai, Salem, Nagercoil, Cuddalore, Kozhikode 22 Jul, 2026

DESCRIPTION
Following Strict Coding Guidelines Within Established Productivity Standards. Addressing Coding Related Inquires for Providers as Needed, U.s. Only. Atten...
botanybiologybiotechnologybiochemistrymedical codingbiomedicalmicrobiology

Site Engineer
Roche International 1.00 to 10.00 Years Delhi, NoidaNoida, Guntur, Bangalore, Chennai, Guntakal, Pune, Mumbai City, AndamanNicobar, Anantpur 22 Jul, 2026

1. Understand all facets of the waste water treatment operations and equipment Must be capable of running the plant effectively in the day to day operations and respond appropriately in emergency...
commissioner activitiesinstallationstpetp operationsite supervision

Urgent Hiring-Biotechnology,Microbiology and Nursing Freshers for Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Delhi, GunturGuntur, Bangalore, Chennai, Vijayawada, Hyderabad, Kolkata, Vishakhapatnam, Pune, Mumba 22 Jul, 2026

HR Bhavani- hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into numer...
cardiologybiotechnologygenetic engineeringneurologyradiologybiomedical engineeringmicrobiologynursingcritical care technology

Landscaper Laborer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Delhi, NoidaNoida, Qatar, Port Blair, Bangalore, Chennai, United Arab Emirates, Hyderabad, Kolkata, 22 Jul, 2026

We are looking for a hardworking and dedicated Landscaper Laborer to conduct general lawn maintenance duties to ensure our customers have a beautiful and healthy outdoor environment. A Landscape...
land acquisitionsupplier managementlaboratory servicessupply managementlabor managementmanagement skillscorporate developmentprivate placementsmaterial management

Wanted Freshers in Neuro Electrophysiology Graduates For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, ThanjavurThanjavur, Thirunelveli, Ramanathapuram, Salem, Tiruchirappalli, Thiruvarur, Krish 22 Jul, 2026

HR Bhavani - hidden_mobile (WhatsApp) Position: Medical Coder Medical Coding is the process of conversion of text information related to healthcare services into nume...
biomedical engineeringphysiotherapynursingmicrobiologyradiologyoptometrycardiologybiotechnologyneurology

Wanted B pharm Fresher For Medical Coding
ISKILLS SOLUTIONS 1.00 to 10.00 Years Chennai, VelloreVellore, Viluppuram, Tiruchengode, Thoothukudi, Salem, Nagercoil, Dindigul, Neyveli, 22 Jul, 2026

Role- Medical Coder: We are looking to hire an fresher Coder (B Pharm, Microbiology, Biology etc.)With strong domain expertise in CPT and ICD (diagnosis) coding, the incumbent should be able to v...
radiologycardiologyanesthesianursingdialysisbiologyzoologybiochemistry

Reliability Manager
SOFT AND HARD SKILL DEVELOPMENT PRIVATE LIMITED 1.00 to 10.00 Years Chandigarh, LudhianaLudhiana, Indore, Vishakhapatnam, Jamshedpur, Hosur, Delhi, Coimbatore 22 Jul, 2026

We are seeking an experienced Reliability Manager to drive equipment reliability, asset performance, and maintenance excellence across its manufacturing operations. This leadersh...
preventive maintenanceasset liability managementreliability engineeringmaintenance engineeringpredictive maintenanceasset managementshutdown management

Chemical Engineer
SAIKOR SECURITY TRAINING AND SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, QatarQatar, Port Blair, Noida, Chennai, Sri Lanka, United Arab Emirates, Hyderabad, Kolka 22 Jul, 2026

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Admin Executive For Factory
HCP Wellness Private Limited 1.00 to 10.00 Years Ahmedabad 22 Jul, 2026

Job Overview: HCP Wellness Private Limited is looking for a proactive and detail-oriented Admin Executive to manage administrative functions, ensure operational efficiency, and support various de...
MS OfficeERP softwarevendor coordinationprocurementfacility managementauditsafety regulationscompliancelabor laws

PREV
NEXT

plant biology Job Openings

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ... chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

DESCRIPTION

Machine Operator

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ... chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Job Description

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ... chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

ERW Quality Manager

DESCRIPTION

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ... chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation

Chemical Engineer Job Description Template We are looking for a creative, cooperative chemical engineer with a wealth of technical and industry ...
chemical analysisanalytical techniquesbioinorganic chemistrychemical productioninorganic chemistrybiophysical chemistryanalytical ultracentrifugation