Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
Primary Skills VC / C , MFC Must have 1.5 years hands on experience Secondary Skills Audio- Video apps such as web conferencing tools, ActiveX, DirectX others. VOIP and MS Visual Studio Kn...
uspatent visualstudio primaryskills secondaryskills webconferencing patentapplication vc mfc mcm java net voip video directx software analysis education pendatabaseconnectivityodbcWe are looking for Iphone/ Ipad application development for the india development center of a leading MNC in the business intelligence space and providers a good opportunity for working on cutting edg...
java spring j2ee hibernate eclipse iossdk primaryskills secondaryskills interfacebuilder businessintelligence applicationdevelopment ui gl ios sdk edge graphics eanimation mobileplatf msGreetings from EJOBS HR SOLUTIONS, We are into Tech Recruitments. Our core competency is into IT Domain. We serve top IT companies in Technopark/ Infopark etc. We are now hiring DBA to our clien...
database sql oracle mysql rac hardening hr cluster performance it ssql sqldba behavioraltraining hrsolutions secondaryskills bordercontrol oraclerac performancetuning oracle10g
Purpose of Role:
Reviewing alerts generated in Automated transaction monitoring tool on a day-to-day basis as allocated using internal and external research tools and determining suspi...
teamskills musicmaking primaryskills problemsolving secondaryskills analyticalskills transactionmonitoring less writing research pressure reporting numerical monitoring analytical ntimoneylaundering structureExperience Required: 4-8 years Notice Period: 30-45 days Please find the JD below for reference: Should have the ability to provide solutions to any technology related challenges that will be faced...
java mysql jsp hibernate spring webservices applicationprogramming automatedtesting sql api j2ee banking testing software estingtools primaryskills secondaryskills salary polymer
&
Purpose of Role:
Manage a team of AML transaction monitoring analysts ad oversee the alerts worked by them. Performing QA on the alerts worked and providing training to the analysts...
UFT+ VB scripting at Sahasya Global Solutions Pvt. Ltd. (2 Opening) Work Experience: 5.0 Year(s) To 8.0 Year(s) Hi Raghu, We are looking for the candidates who can join us Immediate or Max 10 Days...
sql environment java usinessconsulting primaryskills seleniumtesting itservices testdesign testautomation behavioraltraining technologyser customerrelations functionaltesting sqlserver secondaryskillsPlease share cvs for Application/ Production Support for Hyderabad with 6 to 10Years experience Notice Period: Immediate to 30 days only Primary Skills (Mandatory) : Very Good experience on writin...
unixshellscripting scheduling shellscripting sql cvs net unix tservices primaryskills secondaryskills schedulingtools productionsupp windowsautomation applicationsupp kloadautomation itUFT+Selenium at Sahasya Global Solutions Pvt. Ltd. (2 Opening) Work Experience: 5.0 Year(s) To 8.0 Year(s) Hi Raghu, We are looking for the candidates who can join us Immediate or Max 10 Days. Pleas...
java environment sql estautomation customerrelations businessconsulting itservices primaryskills behavioraltraining seleniumtesting technologyser functionaltesting sqlserver testdesign secondaryskillsASP.Net Developer ASP.Net Developer - Lauren Recaptcha requires verification. Im not a robot ASP.Net Developer Building Restful Json APIs using WCF Knowledge of building ASP.Net Web applicati...
sqlserver primaryskills webapplication secondaryskills sql wcf json robot sqlite SQLServerIntegrationServices WindowsCommunicationFoundation spnet TransactSQL SQLServerRep tingServices LanguageInt4 to 6 Yrs Java/ J2EE, Core Java, Servlets, JSPs, JSTLs, EJBs, JMS, Spring (MVC2) Hibernate. Struts, JSF Pentagon Consultancy Services | HR Consultants | Placement Consultants | Recruitment | job cons...
java mysql jsp hibernate spring secondaryskills webapplications consultancyservices hr it sql xml css jsf jms html j2ee ajax soap java3+ years of experience in automation testing using QTP Primary skills Extensive knowledge and experience in QTP. Ability to design automation framework. Ability to write/ execute/ maintain QTP test ...
testcasesregressiontestingautomationjavalifecycletestsuitesprimaryskillstestautomationsecondaryskillsanalyticalskillsautomationtestingtestmethodologiessoftwaredevelopmenttingdesignau5+ years of experience in software testing Primary skills Good experience in Testing, especially with a GUI Automation tools (QTP/ WinRunner/ Silk Test). Comprehensive experience of the entire Testi...
testcasesregressiontestingautomationjavasilktestlifecycletestsuitesprimaryskillstestautomationsoftwaretestingautomationtoolssecondaryskillsanalyticalskillstestmethodologiestingPosition - RPA developer / RPA Process Designer Location - Bangalore Experience - 3 - 5years Required skills At least 2 to 4 years of professional experience in program...
autocaddraftingpipingpfdidsleansixsigmastronganalyticalskillssixsigmaprocessdesignprimaryskillsproblemsolvingprocessanalysissecondaryskillsanalyticalskillsrelationaldatabasesechnicalreqPosition - Trainee Software Engineer Location - Bangalore Type - Frehsres Qualification - Any Engineers graduates / postgraduates with Java certified course or academic projects...
javahtmlcssmysqljavascriptunittestingprimaryskillssecondaryskillsoopsscrumtestingsoftwareengineersanalyticalaggregatescommunicationServletsSwingsJavaDatabaseConnectivityjavaGood understanding of OSI Model, TCP/ IP protocol suite (IP, ARP, ICMP, ) Windows/ Linux/ Citrix (ADS, DNS, DHCP) Network Security, VPN RSA, PKI, Digital Certificate Technical Support (Antivirus...
ciscobgptroubleshootingswitchesosimodelproblemsolvingsecondaryskillsdnspkisslarprsaosiicmpsoundetwkingactivedirectnetwksecuritytechnicalsuppGreetings from EJOBS HR SOLUTIONS, We are into Tech Recruitments. Our core competency is into IT Domain. We serve top IT companies in Technopark/ Infopark etc. We are now hiring DBA to our clien...
databasesqloraclemysqlrachardeningclusterperformancessqlsqldbabehavioraltraininghrsolutionssecondaryskillsbordercontroloracleracperformancetuningoracle10gWe are looking for Iphone/ Ipad application development for the india development center of a leading MNC in the business intelligence space and providers a good opportunity for working on cutting edg...
javaspringj2eehibernateeclipseiossdkprimaryskillssecondaryskillsinterfacebuilderbusinessintelligenceapplicationdevelopmentiossdkedgegraphicseanimationmobileplatfASP.Net Developer ASP.Net Developer - Lauren Recaptcha requires verification. Im not a robot ASP.Net Developer Building Restful Json APIs using WCF Knowledge of building ASP.Net Web applicati...
sqlserverprimaryskillswebapplicationsecondaryskillssqlwcfjsonrobotsqliteSQLServerIntegrationServicesWindowsCommunicationFoundationspnetTransactSQLSQLServerReptingServicesLanguageIntPrimary Skills: 1. Candidate should possess through understanding on Data Networking concepts Routing, Switching, Connectivity and good acumen on troubleshooting. 2. Should have hands on with Cisco ...
secondaryskillsclientrequirementsdnscrsnatbasiccatosvmwareroutingoutagesfirewallcatalystswitchesswitchingmonitcheckpointsolarwindsdiagnosticsconnectivityetwkingingTitle: Advanced Services Engineer 4 Role: Design Validation testing for Financial Services Customer. Location: Bangalore Reporting to the Customer Service Lead, the Design Validation Test Engine...
testcasescustomerservicewebtechnologieswebapplicationsdesignunipernetwksproductslayer2tune100leveldesignpublicsectnetwkdesignsecondaryskillstechnicalsuppproductptfolio3-5 years Chennai Sept. 1 3~5 lac Engineer oriented General oriented 1) knowledge in IT / IoT 2) communication skill in English 3) loyalty spirit 4) Flexibility of working with foreigners and fo...
missalescustomerrelationscustomerservicedeliverypeoplemanagementskillssecondaryskillsmarketknowledgecustomercontactpeoplemanagementmanagementskillsieldsupptechnicalsuppnegotiationskillRoles and responsibilities Location: Chennai Experience: 3 to 9 years Position Type: Permanent Primary skills 1. Core Java 2. Selenium 3. Junit/TestNG 4. Maven 5. Git/...
testcasesregressiontestingautomationjavasecondaryskillsresumeseleniumServletsSwingsJavaDatabaseConnectivitySpringDIStrutsSunCertifiedJavaProgrammerSpringMVCJavaServerPagestingejavaExplore career opportunity with a global technology services, application development and support company. Combining deep domain experience and comprehensive capabilities across latest technologies, c...
themeparksaudiomasteringsecondaryskillsdisasterrecoverytechnologyservicesapplicationdevelopmentmaxodcctclinuxnosqlparksdesignmariadbstrategydatabasekingexperienceTitle: Advanced Services Engineer 4 Role: Design Validation testing for Financial Services Customer. Location: Bangalore Reporting to the Customer Service Lead, the Design Validation Test Engine...
testcasescustomerservicewebtechnologieswebapplicationsdesignunipernetwksproductslayer2tune100leveldesignpublicsectnetwkdesignsecondaryskillstechnicalsuppproductptfolioAbout Business Line GTCB Risk and Control aligns globally to Global Transaction , Custody and Banking which is a part of Global process delivery, team supports Transaction services, Reconciliation (...
insurancequalitysalesmisriskassessmentriskcompliancemanagementprojectmanagementfinancialanalysisustomerrelationsboardofdirectprimaryskillssecondaryskillssenipresentationskillstransactionservicesriskrepTitle Officer / Level 420 Business Line FRFA Work Location Bangalore Process Name Post Trade Investment Compliance Reportees Cost Centre Shifts (in IST) 6:00 PM IST to 3:00 AM IST 7:00 PM IST ...
charteredfinancialanalystvisualbasicmutualfundscompaniesactfinancialrisksharedservicesproblemsolvingtimemanagementclientmanagementusicmakingprimaryskillssecondaryskillsanalyticalskillscodingexperiencefinancPlease share cvs for Application/ Production Support for Hyderabad with 6 to 10Years experience Notice Period: Immediate to 30 days only Primary Skills (Mandatory) : Very Good experience on writin...
unixshellscriptingschedulingshellscriptingsqlcvsnetunixtservicesprimaryskillssecondaryskillsschedulingtoolsproductionsuppwindowsautomationapplicationsuppkloadautomationClient of Forstaffing Kochi, India Full -time Jun, 15 Java Developer (Hibernate) Forstaffing Java Developer (Hibernate) September 15, 2016 Filed under: Published: June 15, 2011 Kochi, India Job Type...
javamysqljsphibernatespringwebservicesapicomj2eerestjavaprimaryskillssecondaryskillsjaxemailbusinessfacebookvacanciesenterpriseTo Hire Sub Con CTH SUNIL KUMAR YEDOTI Primary Skills AIX Admin Secondary Skills Linux Job Description Mandatory 1 Should have 5 year of experience in AIX server administrator 2 Must have very good kn...
communicationskillsserveradministrationpreventivemaintenancetcpipaixtcpnfssshrpmnimestsystemsfilesystemsmusicmakingprimaryskillsmonitingtoolssecondaryskillsperfmanceanalysisscpconQualification & Certifications
Qualification & Certifications Any graduation or similar qualification Primary Skills (Must Have) Oracle SQL PL/ SQL Unix Shell Scripting Secondary Skills (Good to Have) Github Cloud t...
sqlunixcloudagilegithubautosysscriptingunixscriptingshellscriptingunixshellscriptinglsqlacleaclesqlprimaryskillssecondaryskillsPrimary Skill1 : ABAP Other Skill1 : Primary Skill2 : Others Other Skill2 : Functional Knowledge on SD , MM Primary Skill3 : Analytical & Requirement understanding skills Other Skill3 : Se...
admabapsaleslogisticsanalyticalsecondaryskillsQualifications Bachelors Degree Role: ReactJS Developer Skills Hiring For: ReactJS Developer Roles and Responsibilities
© 2019 Hireejobs All Rights Reserved