visual effects creation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

visual effects creation Job Openings

Showing 3001 - 3050 of 8487 Jobs

Graphics Designer

Qualysec Technologies Pvt Ltd 1.00 to 5.00 Years Bhubaneswar 01 Apr, 2025

Proven graphic designing experience

A strong portfolio of illustrations

other graphics

Familiarity with design software

technologies

A keen eye for aesthetics

details

Solid understanding of social media platforms

their content requirements

Ability to work

Technical Trainer

iamneo (Formerly Examly) 2.00 to 8.00 Years Bhubaneswar 01 Apr, 2025

full stack development

mern stack development

java full stack development

mern

dotnet

net full stack development

sdet java

react

Content Marketer

Riaxe Systems 1.00 to 5.00 Years Bhubaneswar 01 Apr, 2025

Business Owner

Ravi creation 5.00 to 9.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Supply Chain Solutions

Relationship Management

Process Improvement

Cost Management

Product Application

Business Strategy Development

ProblemSolving

Content Creator

Pudami Builders 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Social Media Management

Graphic Designer & Video Editor

Unboxx Digital Media 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Graphic Design skills

Logo Design

Branding expertise

Proficiency in Typography

Experience in video editing

production

Knowledge of social media trend

copywriter

Formics Tech LLC 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Technical Content Writer

Elluminati 2.00 to 6.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Content Creator (Camera Facing Role)

JU Enterprise 1.00 to 5.00 Years Rajkot,Other Gujarat 01 Apr, 2025

Video Production Processes

Basic to Intermediate Video Editing Skills

Understanding of Viral Content Trends

Sr. Visual Merchandiser

Urbolife Exclusive 2.00 to 6.00 Years Raipur 01 Apr, 2025

Organizational Skills

ProblemSolving

Graphic Design Internship in Raipur

La Bon Beans & Coffee 0.00 to 4.00 Years Raipur 01 Apr, 2025

Video Editor - Health Animation

Theranize 3.00 to 7.00 Years Raipur 01 Apr, 2025

Organizational Skills

Attention to Detail

Fresher Teacher in D.A.V .School

RENOVISION TECHNOLOGY 0.00 to 1.00 Years Raipur,Bilaspur, Bhillai, Mohali, Hyderabad, Kolkata, Pune, Chandigarh, Mumbai City, Panchkula 01 Apr, 2025

Duties and responsibilities

Design and deliver engaging lessons, content and materials, in line with standard curriculums and teaching standards....
teacher evaluationstudent disciplinestandards-based

Social Media Intern
Vsurgemedia PvtLtd 0.00 to 4.00 Years Patna,Other Bihar 01 Apr, 2025

Company Description Vsurge Media is an AI-powered digital marketing company providing high-quality, data-driven services. Our expertise includes SEO, paid advertisements, social media marketing, ...
Social Media MarketingDigital MarketingMarketingSocial Media Content CreationStrong CommunicationOrganizational SkillsMultitasking Abilities

Graphic Designer
SkyLab SEO 2.00 to 6.00 Years Patna,Other Bihar 01 Apr, 2025

Company Description We suggest you enter details here. Role Description This is a full-time on-site role for a Graphic Designer at SkyLab SEO located in Patna. The Graphic Designer will be resp...
Graphic DesignIllustrationTypographyAdobe Creative SuitePhotoshopIllustratorInDesignWeb DesignBrandingVisual Identity

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Patna,Bhagalpur, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Robotic Engineer Pune_Immediate to 30 Days
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED 2.00 to 6.00 Years Pune 01 Apr, 2025

Warm Greeting for the Day!! We are hiring for the Robotic Engineer which is for Pune Location. Here is the Job Description for the requirement, lidarsensor integrationrosusdcad

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Pune,Jaipur, Bangalore, Jaisalmer, Noida, Chennai, Hyderabad, Gurugram, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Pune,Bangalore, Noida, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Power bi Deveoper
Srijan Spectrum Pvt Ltd 2.00 to 6.00 Years Pune,Bangalore 01 Apr, 2025

Power Bi developer Location-Bangalore, Pune ex-2 to 4yrs notice Period-Immediate o understand business requirements in the BI context and design data models to convert raw data to meaningful ...
power bietl

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Pune,Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Senior Quality Engineer
Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Noida,Delhi, Faridabad, Ghaziabad, Gurugram, Kundli, Manesar 01 Apr, 2025

Dear All candidates. We are hiring for Mnc Tier1 Automotive and Automobile manufacturers for Delhi Ncr locations. we are specialised and well experienced in Hiring for btech Mechanical Engineer...
mechanical engineeringaudit documentationproduction planning controlnew product developmentproduction engineeringquality controlthermoformingproduction scheduling

Social media freelancer
Steel n Glide 2.00 to 6.00 Years Meerut,Other Uttar Pradesh 01 Apr, 2025

Company Description At Steel n Glide, we are dedicated to empowering fitness enthusiasts and athletes with premium-quality gym, sports equipment, and sportswear. Our commitment to innovation and ...
Social Media MarketingDigital MarketingSocial Media Content CreationMarketingCommunicationExcellent written

Pharmacist
Divya Staffing Solution 0.00 to 2.00 Years Mumbai City,Dehradun, Jaipur, Bangalore, Indore, United Arab Emirates, Kolkata, Rishikesh, Dharamsha 01 Apr, 2025

Provides pharmacy services to patients/medical practitioners. Receives, compounds, fills prescriptions, dispenses pharmaceuticals, consults with clients regarding the nature and use of drugs, and...
pharmacovigilancehealthcarenursingpharma

HIRING ||Beauty Advisor |Beauty Brand |Mumbai
ACUTE VISION CONSULTANTS PRIVATE LIMITED 0.00 to 4.00 Years Mumbai City 01 Apr, 2025

HIRING (WFO) ||Beauty Advisor for aBeauty brand based out in Mumbai. Interested applicants ready to appear foran Interview DM your resume to WORK FROM OFFICE make-up artistskincare advisorbeauty consultantbeauty advisormake-up expertproduct expertmake-up advisorskincare consultant

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Nellore, Hyderabad, Gurugram, Kolkata, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Mumbai City,Pune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Kolkata, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Digital Marketing Specialist
Xpert Tutor 2.00 to 6.00 Years Lucknow,Other Uttar Pradesh 01 Apr, 2025

Company Description Xpert Tutor is dedicated to providing exceptional private tutoring services in Lucknow. Acknowledging the shortcomings of traditional teaching methods, we bridge the gap by of...
Digital MarketingSocial Media ManagementContent CreationCopywritingGraphic DesignData AnalysisReportingCommunication SkillsPPC CampaignsSEO OptimizationWeb Traffic Metrics AnalysisMarketing Automation ToolsCRM Software

Fresher Video Editor
Flymedia Technology Ludhiana 0.00 to 4.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Job Title: Video Editor (Fresher) Location:- Ludhiana Job Type: [Full-time/Internship] Experience: (Freshers can apply) Job Summary: We are looking for a creative and detail-oriented Video Edito...
Video EditingAdobe Premiere ProFinal Cut ProDaVinci ResolveVisual EffectsCommunication SkillsTeamwork

,Senior Sales Consultant
Evarastaffing 6.00 to 10.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Job Title: Sales Consultant / Senior Sales Consultant The ideal candidate will develop relationships with individuals seeking hair loss treatment consultations, offering tailored solutions based ...
inside salesb2c salessales consultingbusiness intelligencesalesconsultative sellingstrong written communicationmultitaskingorganizational skillsstrong verbal communicationcatering hni clients

Surface Pattern Designer
JAAMUNI SAMUNDAR 2.00 to 6.00 Years Ludhiana,Other Punjab 01 Apr, 2025

Location: Ludhiana, Punjab, India Jaamuni Samundar is looking for a talented Surface Pattern Designer (Mid-Level) to join our creative team. If you have 2-3 years of experience and a strong passi...
CompositionAdobe PhotoshopAdobe IllustratorSurface Pattern DesignerHandpainting skillsLine drawing abilitiesConceptualization skillsColor development

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Jaipur,Noida, Delhi, Jaisalmer, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Social Media and Community Manager
Mitti - Organic Fresh Desi 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Mitti - Organic. Fresh. Desi. is an Organic Indian Bistro focused on providing healthy and conscious food options to its customers. The menu offers a variety of Indian vegetar...
Social Media ManagementContent CreationCommunity EngagementCustomer Relationship ManagementDigital MarketingInterpersonal SkillsGraphic DesignOnline Brand PromotionExcellent CommunicationKnowledge of Indian CuisineKnowledge of Organic Food Indus

Windows System Administrator
ESDS Software Solution Limited 5.00 to 9.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Windows L3 Admin Role & Responsibility 1. Certification: Certification in Windows server technology is must or equivalent to MCSEMCSA Certification must be active, should not be expired at curre...
OracleMS SqlMongo DBRedisITILIISApacheTomcatDNSActive DirectoryMail serverPerformance OptimizationVMwareHyper vESXIHypervisorTape LibraryiscsiNFSTroubleshootingTeamingBondingWindows server technologyVirtualizationsBackupRecovery

Pharmacist
Divya Staffing Solution 0.00 to 2.00 Years Indore,Bhopal, Dehradun, Jaipur, Bangalore, United Arab Emirates, Kolkata, Rishikesh, Mumbai City, D 01 Apr, 2025

Provides pharmacy services to patients/medical practitioners. Receives, compounds, fills prescriptions, dispenses pharmaceuticals, consults with clients regarding the nature and use of drugs, and...
pharmacovigilancehealthcarenursingpharma

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Hyderabad,Jaipur, Bangalore, Jaisalmer, Noida, Chennai, Gurugram, Pune, Delhi, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Senior Quality Engineer
Xperts Manpower Solutions Enterprises Hiring For MNC Automotive Company 0.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida, Manesar, Kundli 01 Apr, 2025

Dear All candidates. We are hiring for Mnc Tier1 Automotive and Automobile manufacturers for Delhi Ncr locations. we are specialised and well experienced in Hiring for btech Mechanical Engineer...
mechanical engineeringaudit documentationproduction planning controlnew product developmentproduction engineeringquality controlthermoformingproduction scheduling

Video Editor - Advertising Agnecy
MEGMA SERVICES 2.00 to 4.00 Years Gurugram 01 Apr, 2025

ob description

Responsible for managing multiple video projects simultaneously. This includes understanding project requirements, establishing timelines and deadlines....
adobe premiere pro2d animationadobe photoshopmotion graphicsadobe after effectscameravideoadobe illustratortrackingeditor

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Applications Developer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 13.00 to 23.00 Years Gurugram,Delhi, Noida, Jaipur, Bangalore, Jaisalmer, Chennai, Hyderabad, Pune, Guwahati 01 Apr, 2025

Job brief We are seeking a qualified and talented Application Developer to join our team. In this role, you will be responsible for designing and coding functional programs and applications. ...
architecture governancevalue engineeringconstruction managementdeveloper/d2kengineeringapplication architecture

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Sr DOTNET Developer (MVC)
TPHRC PVT LTD 7.00 to 11.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Experience: 7-8 Years Minimum Location: Trivandrum Mode Of work: On Site Responsibilities: Build and maintain application functionality for new and existing systems using the .Net toolset with...
Entity FrameworkSQL ServerHTMLCSSJavaScriptjQueryMVC FrameworkWeb servicesXMLASPNETASPNET CoreEntity Framework CoreREST Web APIs

Creative Content Creator & Presenter
Royal Trading Co (Utsav) 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

We are looking for a female Content Creator & Presenter to develop, present, and publish engaging video content across social media platforms. The ideal candidate should have a strong on-camera ...
Content CreationVideo EditingSocial MediaCreativityStorytelling

PREV
NEXT

visual effects creation Job Openings

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering