2d graphics Jobs

Staff Software Engineer, GenAI and Computational Photography Location: New Taipei, Banqiao District, New Taipei City, Taiwan About the Job: We dev...

Company: NVIDIA Position: Senior Cost Accountant NVIDIA is the world leader in Accelerated Computing. We are passionate about four markets: Gamin...

NVIDIA has been transforming computer graphics, PC gaming, and accelerated computing for more than 25 years. Its a unique legacy of innovation thats fueled by great technologyand am...

: Wipro Limited Wipro Limited (NYSE: WIT, BSE: 507685, NSE: WIPRO) is a leading technology services and consulting company focused on building innovative solutions that address clien...

NVIDIA has continuously reinvented itself over two decades. Our invention of the GPU in 1999 fueled the growth of the PC gaming market, redefined modern computer graphics, and revol...

Design Engineer Job Description We are looking for a talented and detail-oriented design engineer to join our creative team. As the design engin...

design conceptualizationdesign engineeringdesign managementdesigndesign patterns

Hello, We have opening forWordPress & Creative Designer for Gurugram Location . Job Title: WordPress & Creative Designer Location: Gurugram Compensation: Up to 5.5 LPA Working Hours: 12:00 P...
web designingvideo editinggraphic designingwordpress

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  illustratorgraphic designadobe photoshopdesigncreative ability

Graphic Designer - Full-Time Position: Graphic Designer Location: Ludhiana, Punjab, India (Office) Type: Full-Time Company: Netguruze Netguruze, a growing IT service provider, is seeking a pa...
Graphic DesignFigma

We are seeking a talented and detail-oriented Graphic Designer proficient in CorelDRAW and Photoshop. The ideal candidate will have hands-on experience working with laser machines and the ability ...
CorelDRAWPhotoshoppackaging designlaser machinesdigital graphicsillustrations

Role Description This is an internship role for a Video Editor. The Video Editor will be responsible for producing, editing, and color grading video content. Additional tasks include creating mot...
Video ProductionVideo EditingVideo Color GradingMotion GraphicsGraphicsCreativityCollaborationAdobe Premiere ProFinal Cut Pro

Are you passionate about creating dynamic visual stories through motion graphics and animation Join our team and make a lasting impact with your creative expertise! About Us At Koncepts Lab, we...
Motion Graphic DesignAnimationAdobe After Effects3D AnimationCinema 4DBlender

We are looking for an ambitious and self-driven Front-end Developer to join our team. As a Front-end Developer, you will be responsible for implementing visual elements that users see and interac...
javascriptprogramminghtmldevelopment

Key Responsibilities
• adobe creative suitevisual storytellingmarketingadobe photoshopprint designadobe acrobatgraphic designbrandingdigital asset management

We are seeking a talented and experienced Graphic Designer to join our dynamic team. The ideal candidate will possess strong design planning and execution skills, with a keen eye for detail and a ...
Graphic DesignColor TheoryTypographyDesign PlanningExecution SkillsBranding Concepts

Are you a creative designer with a passion for crafting stunning visuals Join our team and bring unique concepts to life! Design and create eye-catching graphics Develop 2D & 3D compositions fo...
Adobe IllustratorPhotoshop

Job description We are seeking a dedicated graphic designer to join our growing company. You will collaborate with other designers to create effective and eye-catching images and campaigns to inc...
Graphic DesigningAdobe SuitePhotoshopInDesign

Graphic Designer Experience: 1 2 Years Area Knowledge of Adobe Photoshop/Illustrator, Corel Draw. Ability to create fresh designs, banners for website & Social Promotions, logo images, icons, br...
Adobe PhotoshopIllustratorCorel Draw

We are looking for a creative and detail-oriented Graphic Designer Intern to join our team. This internship provides an opportunity to work on real-world projects, develop design skills, and contr...
Adobe Creative SuitePhotoshopIllustratorInDesignAfter EffectsTypographyColor theory

We are looking for an ambitious and self-driven Front-end Developer to join our team. As a Front-end Developer, you will be responsible for implementing visual elements that users see and interac...
javascriptprogramminghtmldevelopment

A Marketing Coordinator supports the marketing team by developing, coordinating, and executing marketing campaigns, while also assisting with market research, content creation, and data analysis ...
serviceresearchpubliccustomerdigitalmarketingmanagementsalesmarketstrategycoordinatorevent

Job Description Must have: A portfolio that showcases compelling UX & interaction design skills, creative design thinking and polished visuals. Hindi proficiency is a must have. Demonstrated ab...
UX designInteraction designVisual designColor theoryTypographyLayout designAdobe PhotoshopAdobe IllustratorPrototypingHTMLCreativityVideo productionSound designIllustrationGame mechanicsInformation designCreative design thinkingHindi prof

Key Responsibilities Apply visual effects and graphics to video content on a daily basis Craft CGI and animated character and setting Create computerized animation for a range of different medi...
visual effectsgraphicsCGIanimated charactercomputerized animationmedia

Company Description TechnoGaze Solutions is a leading Digital Marketing & Solutions Company in India, dedicated to delivering cost-effective solutions to clients. The company is promoted by exper...
GraphicsGraphic DesignLogo DesignBrandingTypographyAdobe Creative SuitePhotoshopIllustrator

Company Description At Just Aman Kashyap Corp Pvt. Ltd., we provide innovative IT solutions designed to meet the evolving needs of businesses in todays digital landscape. Our comprehensive servic...
Video ProductionVideo EditingVideo Color GradingMotion Graphics

A Marketing Coordinator supports the marketing team by developing, coordinating, and executing marketing campaigns, while also assisting with market research, content creation, and data analysis ...
serviceresearchpubliccustomerdigitalmarketingmanagementsalesmarketstrategycoordinatorevent

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Company Description Rank First Digital is a leading digital marketing and brand strategy agency based in Agra. We specialize in delivering targeted solutions that drive online visibility, generat...
GraphicsGraphic DesignLogo DesignBrandingTypographyAdobe Creative SuitePhotoshopIllustrator

Job Title: Graphic Designer Job Location : Agra About the Role: We are seeking a talented and creative Brochure and Video Designer to join our team. The ideal candidate will have a strong eye f...
Graphic DesignVideo EditingAdobe Creative SuitePhotoshopIllustratorInDesignAdobe Premiere ProAfter EffectsMotion GraphicsAnimationVisual Storytelling

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  graphic designdesignadobe photoshopadobe illustrator

Sales and Marketing Manager Job Background: As the Sales and Marketing Manager, you will play a pivotal role in driving the growth and success of TIS. You will...
analyticssales strategywebsite managementbrandsocialeventsmonitormedia

• Promo Conceptualization
• Understand the content (TV shows, films, or web series) and create engaging promo concepts tailored for the Tamil-speaking audience.
• Collabora...
  tamilpromovideo

Key Responsibilities
• adobe creative suitevisual storytellingmarketingadobe photoshopprint designadobe acrobatgraphic designbrandingdigital asset management

Design Engineer Job Description We are looking for a talented and detail-oriented design engineer to join our creative team. As the design engin...

design conceptualizationdesign engineeringdesign managementdesigndesign patterns

Job Title: Senior B2B Graphic Designer Experience: 4 to 6 years Location: Noida Excellent communication skills. Compensation : 11 LPA We are seeking a highly creative and experienced Senior B...
Adobe Creative SuitePhotoshopIllustratorInDesignFigma

Key Responsibilities:
• Develop and design engaging graphics for digital and print media, including brochures, flyers, advertisements, social media posts, and website co...
  graphic designdesignadobe photoshopadobe illustrator

Company Description BlueRibbon 3D Animation Studio is a leading 3D Animation studio based in Ahmedabad, specializing in creating outstanding 3D architectural renderings and animations. Since 2010...
3D architectural renderingvisualization softwarewalkthrough animationsflythrough animationsproduct animationscharacter animationswebsite design

You will be responsible for defining segment growth strategy and a sales coverage model to support growth strategies and assign and achieve stretch sales revenue targets and key obj...

*software development in Flash, Photoshop And HTML/CSS with e-learning and web development project domain. *Strong knowledge on Flash Animation *Expert in visualizing animations and interactivity requ...

*software development in Flash, Photoshop And HTML/CSS with e-learning and web development project domain. *Strong knowledge on Flash Animation *Expert in visualizing animations and interactivity requ...

*software development in Flash, Photoshop And HTML/CSS with e-learning and web development project domain. *Strong knowledge on Flash Animation *Expert in visualizing animations and interactivity requ...

Graphic Designer and Video Editor Location: Thane Experience: 0 to 2 years video editingphotoshopgraphic designers