Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Hyderabad Jobs |
Banglore Jobs |
Chennai Jobs |
Delhi Jobs |
Ahmedabad Jobs |
Mumbai Jobs |
Pune Jobs |
Vijayawada Jobs |
Gurgaon Jobs |
Noida Jobs |
Oil & Gas Jobs |
Banking Jobs |
Construction Jobs |
Top Management Jobs |
IT - Software Jobs |
Medical Healthcare Jobs |
Purchase / Logistics Jobs |
Sales |
Ajax Jobs |
Designing Jobs |
ASP .NET Jobs |
Java Jobs |
MySQL Jobs |
Sap hr Jobs |
Software Testing Jobs |
Html Jobs |
We have an urgent opening with a reputed company in AutoAncillary , Sr. Manager General Manager QA (QMS Department) Experience: 20 to 25 Years in Hot Forging & CNC Machin...
internal auditcnc machinequality management systempoka yokecontinuous improvement facilitationmistake proofingmanagement systemmanagement reviewquality managementcustomer satisfactioncustomer requirementsresource managementhot forgingWe have an urgent opening with a reputed company in AutoAncillary , Sr. Manager General Manager QA (QMS Department) Experience: 20 to 25 Years in Hot Forging & CNC Machin...
internal auditcnc machinequality management systempoka yokecontinuous improvement facilitationmistake proofingmanagement systemmanagement reviewquality managementcustomer satisfactioncustomer requirementsresource managementhot forgingWe have an urgent opening with a reputed company in AutoAncillary , Sr. Manager General Manager QA (QMS Department) Experience: 20 to 25 Years in Hot Forging & CNC Machin...
internal auditcnc machinequality management systempoka yokecontinuous improvement facilitationmistake proofingmanagement systemmanagement reviewquality managementcustomer satisfactioncustomer requirementsresource managementhot forgingWe have an urgent opening with a reputed company in AutoAncillary , Sr. Manager General Manager QA (QMS Department) Experience: 20 to 25 Years in Hot Forging & CNC Machin...
internal auditcnc machinequality management systempoka yokecontinuous improvement facilitationmistake proofingmanagement systemmanagement reviewquality managementcustomer satisfactioncustomer requirementsresource managementhot forgingExperience : Graduate/BE/MBA with about 13 to 17 years of relevant experience in planning/forecasting & coordinating the activities of buyers/vendors & members of the procurement team involved in purc...
autoancillary turnkeyprojects commercialvehicle it steel capex plants railways commercial components analytical purchasing procurement negotiation finalization LumpSum ateInteri Interi Fitout TowerErecExperience : Graduate/BE/MBA with about 13 to 17 years of relevant experience in planning/forecasting & coordinating the activities of buyers/vendors & members of the procurement team involved in purc...
autoancillary turnkeyprojects commercialvehicle it steel capex plants railways commercial components analytical purchasing procurement negotiation finalization LumpSum ateInteri Interi Fitout TowerErec
Job Details:
Well versed with GST Statutes and Rules thereunder Attend GST related queries . Interprete provisions under GST and Rules correctly and respond queries Classi...
sales mis accounts tat banking stronganalyticalskills msoffice taxaudits servicetax taxreporting autoancillary taxcompliance externalaudit problemsolving internalcontrol indirecttaxation analyticalskills compliancesupport positionmanagemWe have an urgent opening with a reputed company in AutoAncillary , Sr. Manager General Manager QA (QMS Department) Experience: 20 to 25 Years in Hot Forging & CNC Machine shop Industry: Bearing...
cp it nternalaudit cncmachine qualitymanagementsystem pokayoke continuousimprovementfacilitation mistakeproofing managementsystem managementreview qualitymanagement customersatisfaction customerrequirements resourcemanagement hotforgingJD- 10- 0303 Materials Management Executive (Export Documentation) Delhi/ NCR Auto / Ancillary 3+ Yrs Best in the Industry,...
safety quality sop iso materialsmanagement autoancillary management documentation DGFT xp tdocumentation exp materials Imp tCompliance Exp tAdministration DataImp texp Exp tFinance Exp tControlComJD - 10 - 0416 Shift Leader - Mechanical Maintenance Auto / Ancillary 4 - 7 Yrs Best in the Industr,...
itil sla servicedesk autoancillary mechanical maintenance SolidModeling MachineDesign ToleranceAnalysis echnicalsupp rep ting mechanicalmaintenance bsc DesignEngineering FiniteElementAnalysis PTCCreoHiring - Head - Strategic Sourcing for a leading Manufacturing Company Primarily responsible for sourcing activities at the local unit, will work closely with Sourcing Category Managers. Implementing...
sourcing management negotiation autoancillary globalsourcing management heavyengineering endsupplier alignment suppliers vendJob Description
Experience : Graduate/BE/MBA with about 13 to 17 years of relevant experience in planning/forecasting & coordinating the activities of buyers/vendors & members of the procurement team involved in purc...
autoancillary turnkeyprojects commercialvehicle it steel capex plants railways commercial components analytical purchasing procurement negotiation finalization LumpSum ateInteri Interi Fitout TowerErecJD- 10- 0303 Materials Management Executive (Export Documentation) Delhi/ NCR Auto / Ancillary 3+ Yrs Best in the Industry,...
safety quality sop iso materialsmanagement autoancillary management documentation DGFT xp tdocumentation exp materials Imp tCompliance Exp tAdministration DataImp texp Exp tFinance Exp tControlComThis position is for Electrification Plant to be based in Pune/ Chakan. Manage overall supplier system assessment (SSA) and supplier special process module audit for their capability on technology an...
oem plm ts ualitysystem ts16949 supplierperformance supplierdevelopment iso14001 supplierquality qualityengineering engineeringchange communicationskills costestimation supplieraudit msoffice internalaudit capacityanalysis autoancillarySales Executive - Automobiles - Mumbai Experience: Minimum 2 years (Should have experience of 2 years in automobile industry Car Sales.) Salary: Emoluments will not be a constraint for the right ...
sales marketing businessdevelopment target customerrelations autoancillary mail resume automobile Parcels Scan iCal PostalRegulations USPS PostageMeter MailSorting BulkMailing Sorting ColdCalling alesProcThis position is for Electrification Plant to be based in Pune/ Chakan. Manage overall supplier system assessment (SSA) and supplier special process module audit for their capability on technology an...
oem plm ts ualitysystem ts16949 supplierperformance supplierdevelopment iso14001 supplierquality qualityengineering engineeringchange communicationskills costestimation supplieraudit msoffice internalaudit capacityanalysis autoancillaryWe need BDM for Auto Industries for convenience to corporate clients for Auto accessory part at Gurgaon Location, Near M.G Road metro. Client site Visit days- Wednesday,Thursday and Friday Tuesday i...
management corporates documentation adherence eammanagement autoancillary relationshipmanagement internationalsales corporatealliances clientrelationshipmanagement newbusiness strategicpartnerships clientrelationship businessdevelopmentDesignation: Front Desk Executive Work Location- Andheri East - Chandivali Experience-6 Months to 1 Year experience in the role of Front office representative Key Responsibilities Areas: Greet an...
housekeeping rontdesk autoancillary officeequipment timemanagement managementskills customerrelations consumerdurables adobecreativesuite foodprocessing frontoffice supplychain microsoftofficeCandidates from machine design background concerned to Auto Ancillary industries, Machine tools, SPM, Packaging industries, Welding Automation Knowledge of GD&T, Hydraulics & Pneumatics Candidate must...
plastic bom spm automation packaging machining welding components pneumatics design casting metal hydraulics ontinuousimprovementfacilitation manufacturingdrawings assemblydrawings machinedesign machinetools sheetmetal autoancillary- Receipt Handling PCR & TBR - Dispatch as per Customer Requirement- 100 % adherence - 100% Safety compliance - Inventory & Storage Control - Perpectual Inventory- accuracy - Dealing with Purchase/SCM...
java sql unittesting environment continuousimprovementfacilitation autoancillary dispatch planners logistics ep ting inventUrgent Requirement Company Name :- enco engineering Limited Qualification :- b.tech/diplomamechanical Reporting:- fresher (Passout year must be 2016, 2017 or...
production mechanical system utomobile autoancillaryDear Candidate, we are looking for diploma/b.tech electrical engineer QUALIFICATION : - b.tech / diploma SALARY :- 10500-15000 LOCATION :- delhi , noida , faridabad , ghaziabad , gurugram , IMT ...
productionqualitymobilesystemmechanicalutomobileautoancillaryJob Profile Compensation Candidate Profile Graduate / PG with minimum 10 to 15 years on similar position in a large Manufacturing / Auto Ancillary / Engineering Company. Lead Business Development t...
continuousimprovementfacilitationautoancillarybusinessgrowthstrategicbusinessbusinessdevelopmentoembusinessstrategyengineeringcommunicationContinuousImprovementCultureKaizenRootCauseAnalysisixSBE - Mech. MBA with minimum 10 to 15 years on similar position in a large Manufacturing / Auto Ancillary / Engineering Company. Lead Business Development team. Visiting customers India & Overseas. Ac...
continuousimprovementfacilitationautoancillarybusinessgrowthstrategicbusinessbusinessdevelopmentoembusinessstrategyengineeringContinuousImprovementCultureKaizenRootCauseAnalysisSixSigmaeanMaManager - Tool Room - Auto Ancillary Mfg. - Ahmedabad Company Profile Leading Auto Ancillary Manufacturing Company Located at Ahmedabad - Gujarat. Industry AUTO / AUTO ANCILLARY Location Ahmedab...
airqualitycertifiedtipstrainercontinuousimprovementfacilitationtoolroomautoancillaryprofessionalliabilitymfgvisitgermanmanagementmechanicalvalidationmaintenancecompensationndoavailabil1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustry1 Should have experience in Oil & Gas industry or Lubricant and Auto Ancillary industry. 2 Local Sales candidate preferred with the Geographial and Demographical knowledge.,...
salesautoancillarydivoilgaslocalsalesgasindustryoilgasindustryJob Profile Compensation Candidate Profile Graduate / PG with minimum 10 to 15 years on similar position in a large Manufacturing / Auto Ancillary / Engineering Company. Lead Business Development t...
continuousimprovementfacilitationautoancillarybusinessgrowthstrategicbusinessbusinessdevelopmentoembusinessstrategyengineeringcommunicationContinuousImprovementCultureKaizenRootCauseAnalysisixSExports- Development Delhi Corporate Office B.Tech/ M.Tech(Mechanical) 6- 9 years Job Description 1. APQP 2. Project Management 3. Feasibility Study 4. Interaction with Customers 5. Experience in...
sheetmetalpassengerToleranceAnalysisSolidModelingAssemblyWindchillutomotivepartsmetalautomotiveAssembliesDesignfPlasticPartDesignMechanismDesignVPMSurfaceModelingSteeringASECertifiedBrakJD- 10- 0303 Materials Management Executive (Export Documentation) Delhi/ NCR Auto / Ancillary 3+ Yrs Best in the Industry,...
safetyqualitysopisomaterialsmanagementautoancillarymanagementdocumentationDGFTtdocumentationexpmaterialsImptComplianceExptAdministrationDataImptexpExptFinanceExptControlCom1) Upgrading EHS system as per global requirements 2) Refining corporate EHS strategy 4) Working closely with domain EHS officers 5) Leading plant EHS officer meeting & reviewing MIS 6) Coordinating G...
misehshsestrategyautoancillaryohsassalarybenefitsrefiningreptingautomotivemultinationalTerritory Sales Manager Mumbai-2 and Chennai-1 Qualification & Experience: Graduate with minimum 3 to 5 years of experience in direct & Channel Sales. Preferred from auto accessories and spa...
telematicsusinessdevelopmentsalesb2csalesgpsvehicletrackingsystemautosparepartsautoancillaryb2bsalesResponsibilities:
We have an urgent requirements forAutomobile Executive-Sales profile. Designation: Automobile Executive-Sales Location:- TS TECH (mandal) Private Limited Vitthlapur, Ahmedabad, Gujarat 382120 Exp:-...
salessellingalesmanagementsalesconsultingupsellingrelationshipmanagementchannelsalesautomobilesalessalesexecutiveactivitiesautomotivesalesautoancillaryautomotivenewbusinessdevelopmentautosalessalesexecutiveresilience© 2019 Hireejobs All Rights Reserved