claim investigation jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

claim investigation Job Openings

Showing 51 - 100 of 2128 Jobs

Remote Senior Operations Analyst DataDriven Insights and Resource Planning

remote next 1.00 to 10.00 Years All India 17 Aug, 2026

Predictive Modeling

Forecasting

Performance Reporting

Extraction

Statistical Analysis

Model Development

Resource Utilization Analysis

Industry Trend Analysis

Data Sourcing

Contract Engineer- Mumbai

PES HR Services 1.00 to 10.00 Years Mumbai City, Mira Bhayandar 17 Aug, 2026

residential

billing

evaluation

contract finalisation

Medical Officer Claims Processor

Square Business Services Pvt Ltd 1.00 to 10.00 Years Raipur 17 Aug, 2026

Location:

Experience:

Employment Type:

pharmacology

terminology

AR caller - Senior AR Caller

Starworth Global Solutions 1.00 to 10.00 Years Chennai, Tiruchirappalli 17 Aug, 2026

AR Caller US Healthcare (PB/HB)

AR Callers

US Healthcare

billing

hospital

physician

Data Analyst ( Data Science ) Chennai, Tamil Nadu, India

Arcadia Power, Inc 1.00 to 10.00 Years Chennai 17 Aug, 2026

Exploratory Data Analysis

Customer Service Representative Policy Services & SmallCase Administration

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

technical proficiency

analytical skills

policy services

smallcase administration

decisionmaking

Remote Customer Service Representative Florida FullTime Remote Role

remote zest jobs 1.00 to 10.00 Years All India 17 Aug, 2026

Escalation Management

InboundOutbound Communication

MultiChannel Support

UpsellingCrossSelling

Detailed Documentation

Product Knowledge Mastery

Quality AssuranceKPI Achievement

Trend Reporting

System Issue Reporting

Safety Officer

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Noida, Nepal, Hyderab 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Group Health Underwriter - New Age General Insurance Company - Mumbai.

RightMatch HR Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 14 Aug, 2026

Company

Role

Location

Work day:

quotationunderwritinggroup healthgmcu/whealth underwritingquotesunderwriterhealth underwriter

Safety Officer
AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Gurugram, DelhiDelhi, Noida, Ethiopia, Bangladesh, South Africa, Bangalore, Chennai, Nepal, Hyderaba 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Senior Ar Caller
Starworth Global Solutions 1.00 to 10.00 Years Chennai, Tiruchirappalli 14 Aug, 2026

We are hiring experienced AR Callers for a leading US Healthcare process. The ideal candidate should have hands-on experience in AR Calling, <...
hospital billingphysician billing

Safety Officer
AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Chennai, EthiopiaEthiopia, Bangladesh, South Africa, Bangalore, Noida, Nepal, Hyderabad, Kolkata, Un 14 Aug, 2026

Protect People. Drive Excellence. Build a Safer Future With Us. Are you passionate about creating a safe and healthy work environment Do you have a strong understanding of workplace safety, ...
report writingcommunicationenvironmenthsehealthincident investigationrisk assessmentemergency responsesafety

Hiring Front Line Sales (FLS) | Direct / Agency Channel
DOLPHIN CONSULTANTS Hiring For Hiring Front Line Sales (FLS) | Direct / Agency Channel 1.00 to 10.00 Years Bangalore, ChennaiChennai, Hyderabad 14 Aug, 2026

Hiring Front Line Sales (FLS) | Direct / Agency Channel Location: Bangalore | Chennai | Hyderabad Job Type: Full-time Job Summary relationship managementfront line managementdirect saleslead generationsales

Project Coordinator
DYNAMICENGINEERS INFRATRACK PRIVATE LMIMTED 1.00 to 10.00 Years Ahmedabad, JunagarhJunagarh, Madhya Pradesh, Satna 14 Aug, 2026

Plan project resources and monitor daily/weekly progress across fabrication and site.

Coordinate with design/drawing teams for timely release and approval...
site coordinationteam managementplanningmanpower handlingliasoningcoordinationlabour management

Cluster Medical Director Mumbai
Talent Leads HR Solutions Pvt Ltd 1.00 to 10.00 Years Mumbai City 06 Aug, 2026

1. Clinical Governance & Operational Leadership Provide overarching clinical leadership, administrative supervision, and operational direction to all Medical Officers, nurses, and paramedical st...
clinical governancepediatricsgynecologyleadership

Guidewire Testing Multiple Positions
JKV IT SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Hyderabad 06 Aug, 2026

We have the following 3 Positions on Guidewire Automation Testing with our Direct client at our direct client at Hyderabad. All these positions are Contract to Hire after 6 Months Contract. If yo...
automationguidewire

Ar Caller and Senior AR Analyst
CONVERSE PLACEMENT SERVICES INDIA PRIVATE LIMITED 1.00 to 10.00 Years Hyderabad 06 Aug, 2026

Position: AR Caller Hospital Billing (US Healthcare RCM) Location: Hyderabad medical billinghospital billingcallingaccountsreceivablehealthcarerevenuemanagementdenial managementrcmcycle

Medical Billing Executive
NEXTDIM TECH SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Gurugram 06 Aug, 2026

Job Title: Medical Billing Specialist (AI Billing Specialist) Location: Delhi / NCR About Us: We are a US-based AI technology company at the ...
documentationmedical billingmedical codingpractice managementdata entry

REQUIRED SAFETY SUPERVISOR DABUR INDIA LIMITED
SUMIT KUMAR NEGI 1.00 to 10.00 Years Nagpur, PunePune, Nashik, Nanded, Navi Mumbai, Thane, Maharashtra, Bhubaneswar, Bokaro, Jharkhand 03 Aug, 2026

Contact Person :87,96,58,83,40 Rita Mam
Safety Supervisor Dabur India Limited (Job Description)
safetyregulatory complianceemergency responsesafety officer activitiesrisk managementsafety managementsafety trainingcommunicationsafety audit

Returnship - SME-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a subject matter expert for health care claims within a hybrid global delivery model focusing on accurate adjudication and compliance with HIPAA regulations. Apply deep know...
root cause analysisstandard operating procedureshealth care claims adjudicationHIPAA regulationspayerprovider processesprovider contractingreimbursement methodologiesclaim routing codingproduction reports

US Health Insurance Claims Processor (Voice)
Sutherland 1.00 to 10.00 Years Kochi 03 Aug, 2026

About the RoleJoin a reputable organization as a US Health Insurance Claims Processor specializing in voice-based operations. This position involves handling healthcare claims, ensuring accuracy, ...
insurance claimsHIPAAanalytical skillscommunication skillsinterpersonal skillsdata integrityrecord keepingcompliance

Returnship - TM-Claims HC
Cognizant 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Summary Serve as a senior claims subject matter expert within a hybrid work model night shift environment applying deep knowledge of HIPAA claims adjudication and both provider and payer ope...
provider relationscustomer experienceuser acceptance testingHIPAA claims adjudicationproviderpayer operationshealth care claims processingHIPAA regulationsprovider reimbursement methodologiespayer domain expertise

Claims Inspector Kochi (India)
Driver Logistics 1.00 to 10.00 Years Kochi 03 Aug, 2026

Job Title: Claim Inspector Location: Cochin Experience: 13 Years Job Responsibilities: Inspect tyres and identify defects or damage. Handle tyre warranty claims and prepare inspection...
defect identificationcommunication skillsEnglishMalayalamtyre inspectionwarranty claims

Medical Coding Executive
ACHIEVERS SPOT Hiring For Medical Coding 1.00 to 10.00 Years Erode, ThanjavurThanjavur, Madurai, Tiruchirappalli, Chennai, Salem, Vellore, Kanchipuram, Nagercoil 03 Aug, 2026

As a Medical Coder, you will be responsible for converting healthcare services into standardized codes that are used for billing and insurance purposes. This role requires attention to detail and...
botanybiotechnologybiologybiochemistrybiomedicalmedical coding

Managing Partner
MONEYLICIOUS INVESTMENTS AND CONSULTING SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, ChennaiChennai, Ahmedabad 03 Aug, 2026

Role & Responsibility(Details of the roles & responsibility)

1. Develop a plan to drive the Branch objectives within a location
agent recruitmentagencyunitinsurance agency managementbusiness developmentagency development

Managing Partner
MONEYLICIOUS INVESTMENTS AND CONSULTING SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Ahmedabad, BangaloreBangalore, Chennai 03 Aug, 2026

Role & Responsibility(Details of the roles & responsibility)

1. Develop a plan to drive the Branch objectives within a location
agent recruitmentagencyunitinsurance agency managementbusiness developmentagency development

Remote Senior Operations Analyst Data-Driven Insights & Resource Planning
remote next 1.00 to 10.00 Years All India 01 Aug, 2026

Join arenaflex Where Data Meets Innovation in the Travel Industry Are you reputed company to be part of a dynamic team thats transforming how a global leader serves millions of customers arenafle...
SQLPythonTableauanalytical skillscommunication skillsMS Officedata visualizationstatistical analysisproject management

Auditing Mgr- CS
MEGMA SERVICES 1.00 to 10.00 Years Mumbai City 31 Jul, 2026

Leading Financial services company requires Deputy Mgr/Mgr (Auditing and compliance)- - Mulund-Mumbai ( Only company secretary qualified need apply) One of our client a leading Financial servic...
company secretarial functionscompany secretarial workamalgamationcompanies actsebi regulations

us health care AR caller
CONVERSE PLACEMENT SERVICES INDIA PRIVATE LIMITED 1.00 to 10.00 Years Hyderabad 31 Jul, 2026

Job Title: AR Caller US Healthcare (Provider Side) | SPE/SME Location: Hyderabad Shift: Night Shift Experience: Minimum denial managementar calling

Hiring - Front Line Sales
DOLPHIN CONSULTANTS Hiring For Hiring - Front Line Sales 1.00 to 10.00 Years Chennai, BangaloreBangalore, Hyderabad 31 Jul, 2026

Hiring Front Line Sales (FLS) | Direct / Agency Channel Location: Bangalore | Chennai | Hyderabad Job Type: Full-time Job Summary field salessalesrelationship managercarloan sales

Walkin drive for Fraud Analyst
HCL Technologies Ltd 1.00 to 10.00 Years Bangalore 31 Jul, 2026

HCLTech | Walk-In Drive | Fraud Analyst | 1st Aug 26 | Bangalore Date: 1st Aug 26 (Saturday) Timing:<...
fraud analysisfraud investigationfraud managementfraud controlfraud detection

Fire & Safety Supervisor Dabur India Limited
SUMIT KUMAR NEGI 1.00 to 10.00 Years Patna, BiharBihar, Bhubaneswar, Cuttack, Bangalore, Chattisgarh, Rudrapur, Haldwani, Bhillai, Haridw 28 Jul, 2026

Contact Person :97,17,22,36,28 Renu Mam
Urgent Requirements Post - fire and Safety Supervisor Expe...
safety auditfire fightingsafety officer activitiessafety trainingsafety engineeringsafety case developmentsafety implementationfire safety

Administrative Assistant
NEWAGE TECH SOLUTION PRIVATE LIMITED 1.00 to 10.00 Years Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Gurugram, Mumbai City, Delhi 28 Jul, 2026

Key Responsibilities: - Provide day-to-day administrative and clerical support to senior management and department heads including scheduling, correspondence, and documentation management - Manag...
calendar managementdocumentationtravel coordinationoffice administrationexecutive supportdata entryfilingscheduling

Liaison Officer
TRUE BUDDY CONSULTING PVT LTD 1.00 to 10.00 Years Noida, DelhiDelhi, Faridabad, Ghaziabad, Dharwad, Bellary, Gurugram 28 Jul, 2026

Job Description Executive Action & Liaison Location:PAN INDIA Experience: 1-5 Years Industry: Investigation / Risk Managemen...
due diligenceintelligence gatheringfield investigationsrisk managementgovernment liaison

Customer Service Executives - Full Time
PolicybazaarCom 1.00 to 10.00 Years Meerut 28 Jul, 2026

Job Title: Associate Consultant Services- MEERUT,UTTAR PRADESH Department: Customer Support / Operations Location: Field-based (Customer Visits Required) Employment Type: Full-time Contact Perso...
customer supporthealth insurancedocumentationquery resolutioncustomer servicecommunicationinterpersonal skillstravelproblemsolving

Urgent | Health Claim Facilitator | Mumbai
Shree Balaji Employment Services Pvt Ltd 1.00 to 10.00 Years Mumbai City 28 Jul, 2026

We Are Hiring Health Claim Facilitator Location: Mumbai Key Responsibilities:

Managed cashless and reimbursement health insurance c...
visitclaim investigationfield work

Assistant Manager - Application Security
knowledge Artisan 1.00 to 10.00 Years Kochi 28 Jul, 2026

Were Hiring : Assistant Manager Application Security, IT Audit & GRC (2 Positions) Location : Kochi, Kerala Work Mode : On-site Employment Type : Full-Time Salary : Not a constraint for ...
Application SecuritySecure SDLCVAPTVulnerability ManagementGRCRisk ManagementSecurity ToolsIT Security AuditsERPApplication Security Reviews

Fraud Analyst AML KYC Banking Operations Chargebacks 1PlusYrs | Hyd
WHITE HORSE MANPOWER CONSULTANCY (P) LTD 1.00 to 10.00 Years Hyderabad 28 Jul, 2026

Job Description (JD) Fraud Analyst | AML/KYC | Banking Operations Location: Hyderabad Experience: 14 Years CTC: Up to 4 LPA Shift: US Rotational Shift Notice Period: Immediate to 15 Days Pref...
Fraud InvestigationFraud DetectionAMLAnti Money LaunderingKYCFraud AnalystFraud Operations

Customer Support Associate- Health Claims
FASTSURANCE CONSULTANTS PRIVATE LIMITED 1.00 to 10.00 Years Noida 28 Jul, 2026

Responsibilities:

Support the onboarding and activation of agents, brokers, and intermediaries through internal communication, documentation, and coordination.
<...
claimshealth insurancecustomer supportinsurance

Bodyshop Advisor
NAARA MOTORS LLP 1.00 to 10.00 Years Bangalore 28 Jul, 2026

Body Shop Advisor Company:Naara Kia Motors Location:Bangalore (JP Nagar / Thalaghattapura)Role Overview Naara Kia Motors is ...
repairprepare accurateefficiently resolve customer complaintsinsurance proceduresexplaining repair scopes

Administrative Assistant
NEWAGE TECH SOLUTION PRIVATE LIMITED 1.00 to 10.00 Years Bangalore, NoidaNoida, Chennai, Hyderabad, Gurugram, Pune, Mumbai City, Delhi 28 Jul, 2026

Key Responsibilities: - Provide day-to-day administrative and clerical support to senior management and department heads including scheduling, correspondence, and documentation management - Manag...
calendar managementdocumentationtravel coordinationoffice administrationexecutive supportdata entryfilingscheduling

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Surat, KochiKochi, Rudrapur, Pune, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

Zonal Business Head - Branch Banking
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Ranchi, PatnaPatna, Bhubaneswar, Bangalore, Dehradun, Lucknow, Hyderabad, Kolkata, Bhopal, Guwahati 22 Jul, 2026

Zonal Business Head - Branch Banking Job description Role Summary: Liase with Bank s Zonal officers and ensure alignment on Life Insurance Business Visit zones, regions, distri...
consumer bankingrelationship buildingteam managementinsurance salesbranch bankingbankingbanking operationsretail bankingbranch operations

Chief Security Officer (CSO)
JOBS HELP CONSULTANCY 1.00 to 10.00 Years Noida, DelhiDelhi, Lucknow, Bangalore, Indore, Hyderabad, Jamshedpur, Pune, Bhopal, Patna 22 Jul, 2026

Chief Security Officer (CSO) Key Responsibilities Develop and execute enterprise-wide security strategy covering physical security Oversee security of project sites, plants, e...
security auditssecurity servicessecurity compliancesecurity operations

Inventory Control Manager
FW FUTURESWINGS PRODUCTS & SERVICES (OPC) PRIVATE LIMITED 1.00 to 10.00 Years Meerut, MoradabadMoradabad, Ghaziabad, Lucknow, Varanasi, Firozabad, Faizabad, Agra, Hyderabad, Kolk 22 Jul, 2026

An Inventory Control Manager team supervisiondatatechnicalanalysistime managementanalyticalforecastingskills

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Administrative Assistant
NEWAGE TECH SOLUTION PRIVATE LIMITED 1.00 to 10.00 Years Mumbai City, PunePune, Bangalore, Noida, Chennai, Hyderabad, Gurugram, Delhi 22 Jul, 2026

Key Responsibilities: - Provide day-to-day administrative and clerical support to senior management and department heads including scheduling, correspondence, and documentation management - Manag...
calendar managementdocumentationtravel coordinationoffice administrationexecutive supportdata entryfilingscheduling

Safety Officer
A-ONE STAFFING 1.00 to 10.00 Years Lucknow, AngulAngul, Kollam, Ranchi, Panipat, Coimbatore, Durgapur 22 Jul, 2026

Urgent Requirements Post - Safety Officer Experience - 1yr to 4yr Salary - 22,000 to 38,000 Facility - Living Traveling Canteen Location - Kollam, Lucknow, Ranchi,...
safety inspectionsafety trainingsafety officer activitiessafety auditsafety engineeringsafety analysis

SOC & NOC Analyst
Muthoot Microfin 1.00 to 10.00 Years Kochi 22 Jul, 2026

Role & responsibilities Monitor alerts generated by SOC and NOC tools. Perform first-level analysis and ticket creation. Escalate incidents based on defined procedures. Monitor server, network...
Network Monitoring ToolsBasic NetworkingWindowsLinux FundamentalsSecurity Monitoring ConceptsEndpoint Security ToolsIncident Ticket ManagementBasic Cloud ConceptsCybersecurity FundamentalsSIEM Monitoring

Fire & Safety Supervisor
A-ONE STAFFING 1.00 to 10.00 Years Kochi, RudrapurRudrapur, Pune, Surat, Panipat, Patna 22 Jul, 2026

Urgent Requirements Post - fire and Safety Supervisor Experience - 0 to 5yr Salary - 20,000 to 40,000 Location - Pune, Panipat, Kochi, Rudrapur, Surat, Patna Site - Industri...
safety auditsafety trainingfire protectionsafety case developmentfire alarm systemsafety engineeringsafety officer activitiesfire safetysafety implementation

PREV
NEXT

claim investigation Job Openings

Safety Supervisor Dabur India Limited (Job Description)

Contact Person :97,17,22,36,28 Renu Mam

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers