common software applications jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

common software applications Job Openings

Showing 42351 - 42400 of 44905 Jobs

Ios Developer

AICS Consultancy Service Pvt Ltd 3.00 to 7.00 Years Delhi 04 Oct, 2023

Role : IOSDeveloper Location: Delhi/Mumbai Mode: Work From Office Experience: 3-6 years Mandatory Skills:iOS and Swift Strong understanding of iOS SDK, UI Kit, and other iOS frameworks third party applicationsios developmentios

Applicants for Java Full Stack Developments Application Developer
Accenture 4.00 to 6.00 Years Chennai 04 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
javajavascriptsqlcustomer relationshtmlcore javaspring bootproblem solvingapi developmentbusiness processcommunication skillssoftware engineering

Req. for the post Sr. Engineer - Calibration
Mahindra business & consulting services pvt ltd 4.00 to 5.00 Years Chennai 04 Oct, 2023

Responsibilities & Key Deliverables - Responsible for execution of - steady state calibration development, vehicle level comfort functions, emission regulations for Dies...
steady stateengine calibrationvehicle managementtcpftrcafefleettestsplanninganalysisaltitudeengineersmanagementautomotiveanalyticalvalidation

OIG (Oracle Identity Governance) Consultant
LTIMindtree Limited 3.00 to 8.00 Years Chennai 04 Oct, 2023

Experience: 3 - 12 years Location: All LTIMindtree offices Roles and Responsibilities: Expertise in end-to-end user lifecycle management usin...
oracle adaptive access manageroracle identity manageroigoimoracle access manageroracle idamoracle identity governance

Credit Manager
Aanya Placement Services 2.00 to 7.00 Years Chennai 04 Oct, 2023

Hiring For Banking:
Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ...
financerisk managementrisk

Sr. Application Engineer Pooling L5 &6, AGS
Amazon 4.00 to 6.00 Years Chennai 04 Oct, 2023

Amazon Global Store is looking for a seasoned Sr.Application Support Engineer, who has strong hands-on experience in managing incidents, operational issues and driving operational excellence for l...
plcautomationscadasalesprogrammingknowledge baseuser experienceweb technologiesmobile platformstechnical supportapplication supportbehavioral trainingcustomer experiencesoftware deploymentengineering supportsoftware developmentoperational

Professional, Release Engineering
Fiserv India Pvt Ltd 2.00 to 5.00 Years Chennai 04 Oct, 2023

Calling all innovators find your future at Fiserv. We re Fiserv, a global leader in Fintech and payments, and we move money and information in a way that moves the world. We connect fina...
shell scriptingjavajenkinssvnautomationred hat linuxbug tracking tooldefect tracking toolpostingfortune 500social mediabug trackingproblem solvingdefect trackingagile developmenttest environmentsrelease managementapplication supportbehav

Hiring For Back Office Executive
AKSHITA INTERPRISES 0.00 to 4.00 Years Chandigarh 04 Oct, 2023

We are looking to hire an experienced back office executive to join our busy back office team. As a back office executive, you will be reporting to the back office manager and assisting with vari...
back office operationsadministrationoffice administration

secretary patent
Space Consultant 1.00 to 3.00 Years Bangalore 04 Oct, 2023

Urgent Requirement Profile: Secretary in Patent Department Location: Bangalore Exposure and experience in the e-filing module of the Indian Patent office Desired Skills and Experience: - ...
patentsipr lawse-filing

Logistics Coordinator
EXPONUS TRADELINK PRIVATE LIMITED 6.00 to 11.00 Years Bangalore 04 Oct, 2023

A Logistics Coordinator is responsible for overseeing all aspects of supply chain management, ensuring the flow of raw materials and final products from suppliers to retailers and custome...
high sense of urgencyprioritize workloadcommon senseeffective communicationconfidantkeep organizationquick critical thinkingexcellent customer serviceproblem-solving abilities

Need for the Business Development Manager FCML
BANGALORE JOBHUNTERR INDIA PRIVATE LIMITED 2.00 to 7.00 Years Bangalore 04 Oct, 2023

Designation : Business Development Manager Experience : 1 10 Years Salary : Hike on package MBA Fresher with Excellent Communication can apply Company : One of the MNC company Business Devel...
marketingstore supervisionsalesstores

Art Director
Klaus IT Solutions Private Limited 3.00 to 5.00 Years Bangalore 04 Oct, 2023

ASSIGNMENT RESPONSIBILITIES:

Support the conceptualization and execution of Target.com creative content for the Outdoor Living or Home category.

Suppo...
art directioninterior designing

Senior Graphic Designer
MIPL 1.00 to 6.00 Years Bangalore 04 Oct, 2023

Role: Junior & Senior Graphic Designer (Experience: 2- 5 years) Industry : Corporate Office Space Design Key Responsibilities:

Idea...
corel designerillustratorcreative designgraphic designing

Client Servicing Manager
MIPL 3.00 to 8.00 Years Bangalore 04 Oct, 2023

Job Title: Client Servicing Manager - Corporate Interiors Job Summary: The Client Servicing Manager will be responsible for managing the relationships with clients and ensuring their satisfactio...
client servicingclient relationship management

require for Microsoft Azure Security Security Engineer
Accenture 1.00 to 4.00 Years Bangalore 04 Oct, 2023

About Accenture: Accenture is a global professional services company with leading capabilities in digital, cloud and security. Combining unmatched experience and specialized skill...
firewallnetworkingcustomer relationsidspenetration testinglog analysiswork effectivelyenterprise systems

Fusion PPM Consultant
LTIMindtree Limited 6.00 to 11.00 Years Bangalore 04 Oct, 2023

Position Fusion PPM (Project Portfolio Management) Experience - 5 to 12 Years Notice period - 0- 45 Days Max Job location - LTIM India offices, Job Summary: We are looking for an experience...
project portfolio managementppmcloud project portfolio managementsaas ppmfusion ppmfusion project portfolio managementcloud ppm

Hiring for RPA AA with LTIMindtree.
LTIMindtree Limited 5.00 to 10.00 Years Bangalore 04 Oct, 2023

Developer : Robotics Process Automation (RPA) BOT development and Support 3 years of exp . Development of BOTs for specific use cases that will be assigned from time to time: RP...
a360

Oracle VBCS Developer
LTIMindtree Limited 3.00 to 8.00 Years Bangalore 04 Oct, 2023

3-8 years of total experience in web development using Oracle products, 3 years of relative VBCS experience. Relevant experience of minimum 1 year with OIC is mandatory. oicvisual builder cloud servicevbcsoracle vbcs

Java Node JS Developer
Quess Corp (Magna Infotech) 5.00 to 10.00 Years Pune 03 Oct, 2023

Java Node JS Exp- 5 to 10 yrs Location- Pune Np- 15days to Immediate Skills Required Overall 8 years of experience with minimum 2 years of specific experience in architecting & building Web ...
jirareact.jsjavaspring bootnode.js

Hiring Mechanical Engineer In Nagpur
JS Placement Services 0.00 to 1.00 Years Nagpur 03 Oct, 2023

Designing and detailed engineering of Electrical and control systems aspect of ESS solutions. Sizing and Battery capacity finalization as per the requirement of various global tenders. Design ...
mechanical engineeringelectrical panel design

Graphic Designer
DigiGen Technology Private Limited 4.00 to 8.00 Years Gurugram 03 Oct, 2023

Dear Candidate, We are looking for Graphic Designer in Sector 48 Gurgaon Interested candidate can share their updated resume on hidden_email or can c...
illustrationgraphic designlogo designphotoshopcorel drawgraphic designing

Require now Assistant Manager - Cyber_ ITGC
Acura Solutions 4.00 to 6.00 Years Gurugram 03 Oct, 2023

Owns the SOX Compliance Program and Implementation from an IT standpoint. Be the face to External IT Auditors. Plan, lead and execute the IT SOX and IT and Business Systems Programs and Projects....
pmosox compliance

Applications invited for General Manager / Chief Engineer (Electrical) at APMD
Amity University 5.00 to 14.00 Years Noida 03 Oct, 2023

Applications invited for General Manager / Chief Engineer (Electrical) at APMD - 12-10-2022 - Adv/AUUP/HR/21/093 Advertisement Date: 12-10-2022 Adv/AUUP/HR/21/093 AMITY UNIVERSITY We at Amity Powe...
mechanicalsafetymachineryhvacplumbingair conditioningpower managementcommunication skillsverbal communicationelectrical engineeringpansolarsoundresumeengineersmanagement

Application Database Administrator Oracle Enterprise Applications
IBM India Pvt Limited 3.00 to 5.00 Years Noida 03 Oct, 2023

Introduction In this role, you ll work in one of our IBM Consulting Client Innovation Centers (Delivery Centers), where we deliver deep technical and industry expertise to a wide range of public a...
databasessql serversqldatabase administrationrmanoracle erporacle appsoracle formsexplain planmusic makingprivate sectorweblogic serveroracle workflowperformance tuningoracle applicationsserver administrationerporacle apps dba

Application Developer SAP ABAP HANA
IBM India Pvt Limited 2.00 to 4.00 Years Noida 03 Oct, 2023

Introduction In this role, you ll work in one of our IBM Consulting Client Innovation Centers (Delivery Centers), where we deliver deep technical and industry expertise to a wide range of public a...
javajavascriptsqlcustomer relationshtmlsap fiorifront endsap portalsap mobilesap workflowmvc frameworkprivate sectortechnical designsoftware packagesbusiness knowledgesystem architecturesystem requirementsapplication programmingapplicati

Specialist, Software Development Engineering
Fiserv India Pvt Ltd 5.00 to 7.00 Years Noida 03 Oct, 2023

Calling all innovators find your future at Fiserv. We re Fiserv, a global leader in Fintech and payments, and we move money and information in a way that moves the world. We connect fina...
javascriptjavamysqlhtmlapisoftware development toolspostingfortune 500social mediashared servicescomputer sciencedevelopment toolsbehavioral trainingsoftware developmentinterpersonal skillssensitive informationinformation technologyfinanc

Hiring For System Engineer
HARJAI COMPUTERS PRIVATE LIMITED 4.00 to 6.00 Years Mumbai City 03 Oct, 2023

Location Vashi office Experience 4 to 6 years MAJOR ROLES AND RESPONSIBILITIES Installing configuring operating systems and other software and routinely test installed software for glitch detec...
system engineeringconfiguration

Hiring For Mobile Automation Tester
HARJAI COMPUTERS PRIVATE LIMITED 3.00 to 7.00 Years Navi Mumbai 03 Oct, 2023

3-5 Years Testing with Life insurance domain, Selenium Automation Web Database expertise. Primary Skills: Tester with Life Insurance domain knowledge and expertise in Selenium Automation Web Data...
automationlife insurance

Team Leader
GoldenJobs Placement Solutions Pvt Ltd 2.00 to 7.00 Years Mumbai City 03 Oct, 2023

A Team Leader in the Automobile Industry plays a crucial role in managing a team of professionals involved in various aspects of automotive manufacturing, sales, or service. The specific respons...
communication skillspresentationsales

Medical Coder Vacancy
AKSHITA INTERPRISES 0.00 to 4.00 Years Navi Mumbai 03 Oct, 2023

We are looking to recruit a competent medical coder to assist us with coding medical documentation for insurance claims and for our databases. The medical coder will assign required Current Proce...
modifiersmedical recordsmedical codinge/m codingphysician coding

It Desktop Engineer
Intouch CX 2.00 to 5.00 Years Hyderabad 03 Oct, 2023

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid...
software engineeringdesktop engineering

IT Generalist
Intouch CX 3.00 to 5.00 Years Hyderabad 03 Oct, 2023

Description
About IntouchCX IntouchCX is a global leader in customer experience management, digital engagement, and AI and automation solutions. We immerse ourselves ...
it recruitmentgeneralists

(Senior) Frontend Software Engineer
RyTe4U Consultants 5.00 to 9.00 Years Hyderabad 03 Oct, 2023

(Senior) Frontend Software Engineer (Senior) Frontend Software Engineer Company Description The backbone of the healthcare system is communication between patients and their doc...
automationangularreacttypescriptframework.

(Senior) Quality Assurance Engineer
RyTe4U Consultants 5.00 to 9.00 Years Hyderabad 03 Oct, 2023

(Senior) Quality Assurance Engineer (Senior) Quality Assurance Engineer Company Description The backbone of the healthcare system is communication between patients and their ...
rubyjavascriptcypressrspec

Sales Development Representative
RyTe4U Consultants 1.00 to 5.00 Years Hyderabad 03 Oct, 2023

Job Summary Want to kick off an exciting career with a fast-growing cloud technology business We are looking for highly energetic, customer-centric, driven professionals with s...
sales managementprocessvoicesales coordinationinternationalsales administration

Data Entry Operator | Work From Home | Part Time
Fondstaff Private Limited 1.00 to 5.00 Years Hyderabad 03 Oct, 2023

Dear candidates, We need some candidates who are interested in working with our company as Data Entry Operator. A serious person who can take on various projects of Data entry projects and would...
data entrytypingback officepart timeform fillinglaptopcomputer skillsnon voice processcommunication skills

Work from home as a part-time Data Entry Typist
Fondstaff Private Limited 0.00 to 4.00 Years Hyderabad 03 Oct, 2023

Dear candidates, We need some candidates who are interested in working with our company as Data Entry Operator. A serious person who can take on various projects of Data entry projects and would...
online data entrypart timework from home typingback office executive

Freelancing | Computer Operator | Typing Work | Work From Home
Fondstaff Private Limited 0.00 to 3.00 Years Hyderabad 03 Oct, 2023

Responsibilities: Have to work on company-provided software. Enter data accurately and efficiently into computer systems and laptops. Verify data by comparing it to source documents, detecting a...
data entry typingdata entryhome based data entryms officedata entry operationonline typingcomputer operatingwork from hometyping

Planning Engineering
AVHAD ENTERPRISES 7.00 to 12.00 Years Hyderabad 03 Oct, 2023

We are searching for a well-organized self-starter with great attention to detail to join our team as the new planning engineer. Day-to-day responsibilities include drawing up work schedules and ...
engineering changeengineering documentationplanning engineeringmechanical engineeringenvironmental engineeringengineering change controlengineering consultancyengineering change management

Devops Cloud Engineer
TLG India Private Limited 5.00 to 9.00 Years Hyderabad 03 Oct, 2023

5 to 9 years of experience in Cloud & DevOps with Full time Bachelors /Masters degree (Science or Engineering preferred)

Expertise in below DevOps & Cloud tools: clouddevops

Devops Cloud Engineer
TLG India Private Limited 5.00 to 9.00 Years Gurugram 03 Oct, 2023

5 to 9 years of experience in Cloud & DevOps with Full time Bachelors /Masters degree (Science or Engineering preferred)

Expertise in below DevOps & Cloud tools: clouddevops

Required IT Sales and Marketing Executive for Noida Sector-63
Farmers Trading Company 0.00 to 4.00 Years Noida 03 Oct, 2023

Required Designation-IT Sales Executive- Male Experience-0-6 Years Salary-Negotiable JOB DESCRIPTION- -Engage in cold-calling to create interest in co...
software salessalescold callingmedia salesit salessoftware sales managementad salesadvertisement sales

Photographer
MS Services 1.00 to 2.00 Years Noida 03 Oct, 2023

Urgent Requirement for Photographer
Job Titles :- Assistant Photographer Responsibilities

work with clients to discuss the images they re...
commercial photographystudio photographystill photographyphotography studio

Deputy Manager (Mortgage Loan)
HR Desire 5.00 to 9.00 Years Faridabad 03 Oct, 2023

We have opening for Deputy ManagerHome Loan, kindly find the job details below: Mandatory to fill: Tracker

Post Applied for
home loansmortgage loans

Devops Cloud Engineer
TLG India Private Limited 5.00 to 9.00 Years Noida 03 Oct, 2023

5 to 9 years of experience in Cloud & DevOps with Full time Bachelors /Masters degree (Science or Engineering preferred)

Expertise in below DevOps & Cloud tools: clouddevops

.NET Tech Lead
Infosys Limited 2.00 to 4.00 Years Chennai 03 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to get to the heart of customer issues, diagnose problem areas, design innovative solutions and...
client interfacing skillssoftware configuration managementteam managementproblem solvingsolution designmanagement systemsclient interfacingtechnology solutionsdigital transformationbusiness profitabilityconfiguration managementorganizational in

Project Manager PMO
Acme Services Private Limited 6.00 to 11.00 Years Chennai 03 Oct, 2023

Project Manager PMO
Job description Project Management Skills Strong in ITIL processes ERP skills. SAP is most preferred (In any Module) Understanding of Integration with t...
businessprocessdebuggingmanagement

Logistics Coordinator
EXPONUS TRADELINK PRIVATE LIMITED 6.00 to 11.00 Years Chennai 03 Oct, 2023

A Logistics Coordinator is responsible for overseeing all aspects of supply chain management, ensuring the flow of raw materials and final products from suppliers to retailers and custome...
high sense of urgencyprioritize workloadcommon senseeffective communicationconfidantkeep organizationquick critical thinkingexcellent customer serviceproblem-solving abilities

VBCS Associate Consultant
Infosys Limited 0.00 to 2.00 Years Chennai 03 Oct, 2023

A day in the life of an Infoscion As part of the Infosys consulting team, your primary role would be to get to the heart of customer issues, diagnose problem areas, design innovative solutions and...
sqljavacustomer relationssapdocumentationoracle fusion middlewareclient interfacing skillssoftware configuration managementweb servicesoracle fusionteam managementweb developmentproblem solvingsolution designweb applicationsmanagement syste

Senior Practitioner Finance and Administration Delivery
IBM India Pvt Limited 2.00 to 4.00 Years Chennai 03 Oct, 2023

Introduction The Finance & Admin Business Analyst is essential to the ongoing profitable operations for one of the most globally recognized and respected companies in the world. By overseeing our ...
customer servicecustomer relationsslacrminsuranceorder to cashms officedirect debiterp softwareservice leveltime managementjournal entriesbusiness analysischange managementcash applicationsaccounts receivableinterpersonal skillseducationa

PREV
NEXT

common software applications Job Openings

Hiring For Banking:

Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ... financerisk managementrisk

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid... software engineeringdesktop engineering

Description

Urgent Requirement for Photographer

Job Titles :- Assistant Photographer Responsibilities work with clients to discuss the images they re... commercial photographystudio photographystill photographyphotography studio

Job description Project Management Skills Strong in ITIL processes ERP skills. SAP is most preferred (In any Module) Understanding of Integration with t... businessprocessdebuggingmanagement

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Credit Manager We are looking to hire an experienced credit manager to oversee our companys lending process. As a credit ...
financerisk managementrisk

Job description About the Job Were looking for an IT Desktop Generalist to maintain and repair computers, hardware, and software in a break/fix environment. The ideal candid...
software engineeringdesktop engineering

Job Titles :- Assistant Photographer Responsibilities

work with clients to discuss the images they re...
commercial photographystudio photographystill photographyphotography studio

Job description Project Management Skills Strong in ITIL processes ERP skills. SAP is most preferred (In any Module) Understanding of Integration with t...
businessprocessdebuggingmanagement