creating templates jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

creating templates Job Openings

Showing 2651 - 2700 of 16851 Jobs

Video Editor

CONSULTBAE INDIA PRIVATE LIMITED Fresher Delhi, Gurugram 01 Oct, 2025

Role-

Experience-

Working Mode-

Location

What Youll Do video editingsocial media

Travel Executive Ticketing
Williams Consulting Pvt Ltd Fresher Delhi 01 Oct, 2025

Job Title: Travel Executive Ticketing & Holiday Packages

holiday packagestravel servicesdestination managementdestination servicestour packagesfamily holidayshospitality

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Noida, ChennaiChennai, Pune 01 Oct, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Administration Coordinator
GALLAGHER AND MOHAN PRIVATE LIMITED Fresher Delhi, NoidaNoida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Oct, 2025

Hiring For Administration Coordinator

Company Overview:
Gallagher & Mohan is a distinguished firm providing financial analysis, mar...
data managementclient coordinationteam coordination

Automation Test Engineer
Delta Sys-Tech (India) Pvt Ltd Fresher Chennai, Pune 01 Oct, 2025

Permanent job opening for Automation Test Engineer with MNC organization at Chennai / Pune Job Description Immediate 15 days Years of Experience 6 9 / 9 13 ye...
rest apiautomation testingmavengradle

RPA UIPath Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, NoidaNoida, Pune 01 Oct, 2025

Connect me over my mail - hidden_email or whatsapp me onhidden_mobile This role will be responsible for design, build, test and support au...
uipathstudioorchestrator

Lead Full Stack Developer
Inferenz Fresher Ahmedabad, Gujarat 01 Oct, 2025

As a Senior Full Stack Developer at Inferenz, you will play a crucial role in building innovative Generative AI (GenAI) based applications. Your responsibilities will include: - Full-Stack Develo...
PythonAzureAWSKubernetesmicroservicesGitJiraConfluenceREST API developmentNodejsReact

Mechanical Production supervisor
Khodiyar Engineers Fresher Ahmedabad, Gujarat 01 Oct, 2025

As a Mechanical Engineer at our company based in Ahmedabad, Gujarat, you will be responsible for the following tasks: - Delivery of orders within specified timelines - Arranging short materials r...
manpower managementknowledge of MSOffice

3D Generalist
Capermint Technologies Fresher Ahmedabad, Gujarat 01 Oct, 2025

As a 3D Artist at Capermint Technologies, your role will involve creating high-quality 3D models, designing textures, rigging, animating characters, and optimizing assets for mobile and PC games. ...
3D modelingtexturingcharacter designrigginganimationSubstance PainterPhotoshopBlenderZBrushUnityUnreal Enginelightingshading

Sap Functional Consultant
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Mumbai City, Delhi 28 Sep, 2025

Primary Scope & Responsibilities: Subject Matter Expert for Forecast to Pay (FTP) in the areas of Retail and Ecommerce. Strong understanding of FTP processes and the ability to configure it acc...
stofunctionalftpretail

Senior Fullstack Developer
Wolters Kluwer Fresher Pune, Maharashtra 28 Sep, 2025

As a skilled developer, you will collaborate with a team to deliver end-to-end solutions, encompassing coding and defect fixes. Your focus will be on creating scalable solutions and collaborating ...
Object Oriented programmingMS SQLMySQLHTMLCSSJavaScriptjQueryAngularJSDesign patternsTest Driven DevelopmentTDDUnit testingCode coverageNUnitDebuggingSolution DesignApplication ArchitectureREST servicesNet FrameworkNET COREASPNet MVC

React JS C Fullstack Developer
GlobalLogic Fresher Nagpur, Maharashtra 28 Sep, 2025

You will be responsible for developing and maintaining software using ReactJS, Typescript, JavaScript, and C# with a solid understanding of DICOM standards, clinical workflows, and imaging. Prefer...
JavaScriptimagingReactJSTypescriptDICOM standardsclinical workflowsOHIF

JD Edwards SND Consultant
LTIMindtree Limited Fresher Hyderabad, BangaloreBangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 28 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

Appian Tech Lead
Best Infosystems Ltd Fresher Delhi 28 Sep, 2025

Appian Tech Lead_Full-Time_Remote_India Job Tittle: Appian Tech Lead Job Type: Full-Time Experience: 8 years in IT, with a minimum of 6 years in Appian development Location: Remote (India-based ...
leadershiptechnical

Support Analyst Tier 1/ Tier 2 Hybrid
myKaarma Fresher Noida, Uttar Pradesh 28 Sep, 2025

Role Overview: As a Support Analyst Tier 1 & Tier 2 at myKaarma, you will play a crucial role in providing front-line support for U.S.-based customers, handling Tier 1 and Tier 2 technical issues....
Technical SupportSQLDebugging toolsZendeskSalesforcemicroservicesSpring BootJavaJiraCustomer Service ExcellenceSaaS platformsPostmanCRMticketing tools

SDE 2 - Backend
Saathi Fresher Delhi 28 Sep, 2025

As a high-performing and curious Senior Software Engineer at Saathi, you excel in a fast-paced environment and are passionate about contributing to the development of robust, scalable systems. You...
Javadata structuresalgorithmsdesign patternsMongoDBGitRESTful APIsKafkaElasticsearchdistributed systemsDockerAWSNodejsobjectoriented programmingsoftware design principlesmicroservices architecturecaching strategies

Analyst 3, Supply Chain Planning
Comcast Fresher Chennai, Tamil Nadu 28 Sep, 2025

Role Overview: As a Senior Supply Planner at Comcast, you will be responsible for managing inventory levels and availability, overseeing product lifecycle management, and contributing to strategic...
Inventory ManagementProduct Lifecycle ManagementData AnalysisBusiness IntelligenceAnalyticsSalesOperations Planning SOPSupplier Performance ManagementStrategic Supply Chain Planning

Senior Specialist - Package Implementation
LTIMindtree Limited Fresher Bangalore 28 Sep, 2025

Skill cluster Technical consultant Sap Data Services LTIMindtree is looking for dynamic highenergy and highperforming individuals to be a part of their Powered Enterprise journey Powered Enterp...
Sap Data Services

Data Analyst Intern (Fresher)
Constrotech Associates Fresher Pune, Maharashtra 25 Sep, 2025

You will be responsible for supporting data management and reporting processes at ConstroTech Associate LLP. Your role will involve creating dashboards, analyzing data, and providing actionable in...
MS ExcelMS WordPower BIDAXPythonSQL

Marketo
LTIMindtree Limited Fresher Pune 25 Sep, 2025

Role Marketo Developer Skill Marketo KnowledgeHTMLCSSVelocity ScriptingBasic SQLRest API Knowledge Minimum Skill Requirements This exciting and interesting position will have the below respons...
Marketo

Opportunity for AWS Cloud Architect Role in Pune
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Pune 25 Sep, 2025

We are currently looking for an AWS Cloud Architect with 7 to 10 years of experience to join our team in Pune. Below are the key details of the role: Role: AWS Cloud Architect Experience: 7 to ...
awscloud

JD Edwards SND Consultant
LTIMindtree Limited Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Delhi 25 Sep, 2025

Role -JDE SND Exp - 2 to 8 Yrs Salary - Best in Industry Location - PAN India Sales and Distribution domain knowledge and experience. Having at least 2 full life cycle implementation experien...
jde - distributionjde

QA Tester Full Time
Best Infosystems Ltd Fresher Chennai 25 Sep, 2025

QA Tester_Full Time_Chennai_Work From Office Job Title: QA Tester Job Type: Full Time Experience: 4-9 years Location: Chennai Shift Timing: 11 AM to 8 PM Job Discription: Technical Expertise R...
qa testingtesting

SAP Work Manager Developer
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Chennai, BangaloreBangalore, Noida, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, Delhi 25 Sep, 2025

SAP WorkManager: Primary Skill: SAP Work Manager Delivery Role: Sr. Developer Experience Profile: 06-10 years Candidate should have good knowledge and working experience of SAP Agentry/Work M...
spmmobile developmentjavasap work managerworkdevelopermanager

Travel Desk Executive
Bankai Infotech Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Travel Coordinator at our company, your role will involve booking travel arrangements for employees or clients, both domestic and international. You will be responsible for creating detailed ...
Travel arrangementsCustomer serviceBudget managementLogistics coordination

Lead Data Engineer
Anblicks Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Senior Data Engineer, your role will involve developing scalable data pipelines using Microsoft Fabric. Your responsibilities will include: - Developing and managing data pipelines through M...
Version controlDocumentationSQLPythonMicrosoft FabricData pipelinesMicrosoft Fabric Data FactoryOneLakeMetadata taggingBatch trackingCICD integrationObservabilityAzure Data FactoryDatabricksSynapsePySparkData catalogingLineage

Sales Distributor
Saathi Fresher Ahmedabad, Gujarat 25 Sep, 2025

As a Sales & Distribution personnel at Saathi, your role will involve developing and implementing sales & distribution plans for Saathi sanitary pads locally and internationally. You will be respo...
distributorsMicrosoft OfficedocumentationEnglishModern TradeGeneral tradeInternational salesStrategic thinkingCompetitive analysisAdobe Creative Suiteknowledge of consumer product channelsecommerce platformFMCG IndustryStrong writtenverbal c

Manufacturing Materials Procurement & Inventory Management Entry Professional
Hitachi Careers Fresher Vadodara, Gujarat 24 Sep, 2025

As a Factory Buyer at Hitachi Energy in Maneja-Vadodara, India, you will be an integral part of the Transformers Business Unit (BU) team. This team is dedicated to utilizing innovative technology ...
ProcurementSupply Chain ManagementVendor ManagementInventory ManagementCost OptimizationERPSAPLean ManufacturingKANBANVMIRisk EvaluationEngineering Drawing

Anesthesiologist
ETHOS HR MANAGEMENT AND PROJECTS PVT LTD Fresher Vadodara, Anand 24 Sep, 2025

Health Equity is a start-up which is now, one and half year old. Health Equitys mission is to take modern and professional healthcare to the last citizen in our villages. Health Equity is commit...
anesthesiologyanesthesia

Web Content Writer
Tempsens Instruments (I) Pvt Ltd Fresher Udaipur, Rajasthan 24 Sep, 2025

As a Technical Content Writer at Tempsens located in Udaipur, Raj, you will play a crucial role in creating high-quality content for the companys website, blogs, and marketing materials. Your prim...
Keyword researchGoogle AnalyticsWritten communicationVerbal communicationSEOoptimized technical content writingContent marketing strategiesContent management systems CMS

Information Security Analyst - Vulnerability Management
Secure Meters Limited Fresher Udaipur, Rajasthan 24 Sep, 2025

You will be working as a part of the IS department, requiring 2 to 5 years of experience, on a full-time basis with the flexibility to work from anywhere. Your primary responsibilities will incl...
VAPTEthical HackingSecurity TestingWeb TechnologiesOperating SystemsOWASPNetwork ProtocolsCertified Ethical Hacker CEH

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

District Manager
MNR Solutions Pvt Ltd Fresher Surat, SurendranagarSurendranagar, Gujarat, Tamil Nadu, Chittorgarh, Rajasthan, Hosur, Mysore, Karna 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Laravel Developer
Param Software Fresher Rajkot, Gujarat 24 Sep, 2025

Role Overview: As a Full Stack Laravel Developer at Param Software, you will be responsible for designing, developing, and maintaining high-quality web applications using the Laravel framework. Yo...
PHPMySQLOOPHTMLCSSJavaScriptGitRESTful APIsAWSAzureLaravel frameworkVuejsReactMicroservices ArchitectureLaravel LivewireInertiajs

Head of Marketing
RAJPUT PROTECTION SERVICE PRIVATE LIMITED Fresher Cuttack, AustraliaAustralia, Canada, Muzzafarpur, Guwahati, Gwalior, Chennai, Rajkot, Netherlands, A 24 Sep, 2025

Job brief We are seeking a dynamic Head of Marketing to take charge of all marketing initiatives, including social media, digital campaigns, advertising, and creative projects. As the Head o...
product developmentmarketing managementbrand managementmarketing communicationmarketing strategymarketing research

presales consultant
BSH TECHNOLOGIES PRIVATE LIMITED Fresher Bhubaneswar 24 Sep, 2025

Work closely with the Business Development & Sales teams to support lead qualification and opportunity conversion.

Conduct r...
crmpresentationsclientsmbsoftwaresalestoolsexcelpowerpointdemosmarketproposalsstrongmandatory.knowledgesystems.serviceslikeestimationsusing

Workfront Specialist Opportunity at Capgemini - PAN India location
CAPGEMINI TECHNOLOGY SERVICES INDIA LIMITED Fresher Bhubaneswar, BangaloreBangalore, Noida, Chennai, Hyderabad, Kolkata, Gurugram, Pune, Mumbai City, De 24 Sep, 2025

We are currently looking for a professional with strong experience in Workfront Development to join one of our clients. Please find below the key responsibilities and skill requirements for this ...
fusiondevelopment

Graphics Designer
Optimize For SEO Fresher Ranchi, Jharkhand 24 Sep, 2025

Job Overview Optimize For SEO is a rapidly growing company in the Digital Marketing industry, and we are currently seeking a skilled Graphics Designer professional to become a part of our team. I...
Social Media MarketingAdobe IllustratorAdobe PhotoshopCreativity

Hiring For Clinical Research Associates
DEVIKA STAFFING SOLUTION Fresher Raipur, SurgujaSurguja, Surat, Vadodara, Oman, Qatar, Saudi Arabia, Ahmedabad, Kuwait, Gujarat, Raja 24 Sep, 2025

We are looking for an organized, flexible clinical research associate to oversee clinical trials. The clinical research associate will develop and outline trial protocols, establish trial sites, ...
pharmapharmacovigilancehealthcaremedical coding

Dot Net Developer
Ariel Software Solutions Fresher Punjab 24 Sep, 2025

You have an exciting opportunity to join our team as a Software Developer in Mohali, Punjab. With 1 to 4 years of experience, you will be responsible for creating top-quality applications and mana...
NETHTMLCSSJavaScriptAJAXjQueryBootstrapAngularJSSQL ServerMYSQLMongoDBPostgreSQLAutofacUnityNinjectNUnitXUnitMSTestNET languages CNET framework MVCNETWeb APIReactJSNET 45Net CoreEntity Framework 6EF CoreNHibernateADONETDepende

Senior 3D Artist
ChicMic Studios Fresher Punjab 24 Sep, 2025

Role Overview: You will be a skilled and imaginative 3D Artist joining our team, with a strong foundation in 3D modeling, texturing, and rendering. Your main responsibility will involve collaborat...
3D modelingtexturingrenderingBlenderMayaZbrushSubstance PainterUnreal EngineUnityMarvelous DesignerKeyshotanimationriggingMarmoset ToolbagRoblox

Magento 2 Developer
Sookshum Labs Technologies Private Limited Fresher Punjab 24 Sep, 2025

As a Magento Developer at Sookshum Labs, your primary responsibility will be to develop, customize, and maintain Magento 2-based websites. You will collaborate closely with a team of developers to...
HTMLCSSJavaScriptAPIsjQueryPHPRESTSOAPUI DesignAWSGCPCommunication SkillsMagento Best PracticesRelational Database SystemsObjectOriented ProgrammingProblemSolvingOrganizational SkillsGIT Version Control

Shopify Theme Developer
Akuna Technologies Fresher Mysore, Karnataka 24 Sep, 2025

The ideal candidate for this role should have a minimum of 2 years of experience in Shopify Development. You will be responsible for designing and developing custom Shopify Themes, working on both...
HTMLCSSJavaScriptShopify DevelopmentTheme DesignsLiquid TemplatesShopify App integrationsWeb design standards

District Manager
MNR Solutions Pvt Ltd Fresher Mysore, HosurHosur, Karnataka, Tamil Nadu, Gujarat, Chittorgarh, Rajasthan, Surat, Surendranagar, Er 24 Sep, 2025

Responsible for Sales and collection target achievement Expanding into new talukas Expanding franchisee network and increasing dealer share of wallet Ensuring marketing camp...
farmersdistrict sales managementchannel salesdealer sales

Digital marketing video and poster editing freshers 3 months unpaid internship
software development and graphic design Fresher Madurai, Tamil Nadu 24 Sep, 2025

Role Overview: As a Digital Marketing Video and Poster Editing Intern at our dynamic software development and graphic design company, located in Madurai, you will be responsible for assisting in c...
Social Media MarketingOnline MarketingDigital MarketingWeb AnalyticsCommunication skillsCollaborationAttention to detailCreativity in visual content creationEnthusiasm for learningAdapting to new technologies

Territory Sales Manager
Confidential Fresher Madurai 24 Sep, 2025

Role & Responsibilities We are looking for a Software Engineer with 3 to 6 years of experience in developing, configuring, and customizing Product Lifecycle Management (PLM) sol...
javascriptrallyautomationjirarobotseleniumgoodpycharmtestingpythonframework

Siddha and Homeopathy
CORE 2 CODE Hiring For C2C Healthcare Fresher Madurai, TiruchirappalliTiruchirappalli, Coimbatore, Chennai, Salem, Cuddalore 24 Sep, 2025

Dear candidate I am Lavanya HR at C2C Healthcare We are hiring 50 -100 Siddha and Homeopathy candidate for the position of Junior Medical Coders Eligibility Siddha and Homeopathy 2019 - 2025...
anatomycommunication skillsenglishinterpersonal skills

Branch Manager
BN Recruitment Services Hiring For Bank Fresher Madurai, TiruchirappalliTiruchirappalli, Erode, Coimbatore, Vellore, Hosur, Nagercoil, Thiruvarur, T 24 Sep, 2025

Hiring For Banking:
Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas...
decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving

Area Business Manager
Lactinova Nutrition PvtLtd Fresher Ludhiana, Punjab 24 Sep, 2025

You will be responsible for developing the potential market for Cattle Feed, establishing a distribution network in targeted markets, tracking purchase and sales channel partners, creating awarene...
SalesMarketingMarket AnalysisTeam ManagementCustomer ServiceBusiness DevelopmentSales StrategiesBudgeting

Angular - Web Developer
Roots Infocomm Private Limited Fresher Ludhiana, Punjab 24 Sep, 2025

As a skilled Web Developer, you will be responsible for developing and/or designing web applications while collaborating with a team of developers. Your role will involve creating, maintaining, an...
AngularJavaScriptHTMLCSS

PREV
NEXT

creating templates Job Openings

Job Title: Travel Executive Ticketing & Holiday Packages

Hiring For Administration Coordinator

Company Overview:

Hiring For Banking:

Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas... decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Branch Management We are looking for a results-driven Branch Manager to ensure that sales goals are met and office tas...
decision-makingcommunication skillscustomer relationshipbranch operationsproblem solving