drafting reports jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

drafting reports Job Openings

Showing 11951 - 12000 of 35842 Jobs

Area Sales Manager

Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Database Manager

Divya Staffing Solution 0.00 to 4.00 Years Hyderabad,Bangalore, Kochi, Chennai, Nellore, Vijayawada, Vishakhapatnam, Other Kerala, Belgaum, Coi 01 Apr, 2025

Nuclear Medicine Molecular Biology

ACHIEVERS SPOT 0.00 to 1.00 Years Hyderabad,Bangalore, Chennai, Other Tamil Nadu, Vellore 01 Apr, 2025

Franchise Sales Manager

MEGMA SERVICES 7.00 to 12.00 Years Hyderabad,Other Telangana, Bangalore, Chennai, Pune, Mumbai City, Ranchi 01 Apr, 2025

franchsie development manager

franchise sales manager

Regional Sales Manager-Project sales( construction chemicals)

MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Hyderabad,Bangalore, Cuttack, Amritsar, Jalandhar, Pune, Delhi, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Ethiopia, Bangladesh, Anantpur, Bangalore, Noida, Chennai, Kolkata, Gurugram, Pune, Mumbai 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Quality Engineer
AES INDUSTRIAL PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad,China, Iran, Other Haryana, Other Bihar, South Korea, Other Assam, Iraq, Bangalore, Philip 01 Apr, 2025

Job brief
Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Hyderabad,Bangalore, Chennai, Bhagalpur, Kolkata, Gurugram, Mumbai City, Delhi, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Pharmacovigilance Associate
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

DLP Specilaist
MNR Solutions Pvt Ltd 3.00 to 7.00 Years Hyderabad,Gurugram, Delhi 01 Apr, 2025

DLP Location-Pan India Grade-P2/P3/P4 NP-30 days Job Overview: We are seeking a skilled Data Loss Prevention (DLP) Specialist to join our I...
qradardlpseim

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Delhi 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

Nurse Practitioner Opening
Divya Staffing Solution 0.00 to 2.00 Years Gwalior,Indore, Bhopal, Jabalpur, Jaipur, Navi Mumbai, Kolkata, Pune, Mumbai City, Ahmedabad 01 Apr, 2025

The clinical research associate will manage multiple aspects of the subjects welfare. You will conduct regular site visits, generate and distribute internal and external newsletters, prepare fin...
healthcarenursingpharmacovigilancepharmaceutics

Operations Manager
WorkMint 0.00 to 4.00 Years Gwalior,Indore, Bhopal, Mandideep, Pithampur, Rewa, Dewas, Chhindwara, Singrauli, Balaghat 01 Apr, 2025

WorkMint Hiring For Banking Operations Manager Job Description Provide day to day planning and tracking support to field operations to ensure efficient and effective operations. 2. Del...
back office operationsbackend operationsback office management

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Purchase Manager - Sec 43, Gurgaon ( Food Industry Experience )
Alpha Pro Services Hiring For Alpha Pro Services 1.00 to 6.00 Years Gurugram 01 Apr, 2025

Position - Purchase Manager - Male Location:Sec 43, Gurgaon Job Responsibilities :- Research potential vendors. Compare and evaluate offers f...
procurementvendor managementpurchasefood

Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram
HR Globe Recruitment Service 3.00 to 8.00 Years Gurugram 01 Apr, 2025

Dear Candidates, Urgent | Hiring for Admission Head for Corporate Pre school at Gurugram Salary upto 55k Interested candidates please call hr on hidden_mobile 1. Me...
parent communicationcounsellinglead generationpreschoolonline lead generation

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Freshers, Exp - Sales Associates - EV Charger Manufacturer
Avani Consulting 0.00 to 3.00 Years Gurugram 01 Apr, 2025

Greetings from Avani Consulting We are hiring for the below opportunity: Company: A leading EV charger manufacturer, revolutionizing the electric vehicle charging ecosystem. <...
sales coordinationchargerslithium-ion batteriesbattery

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Quantity Surveyor
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Guwahati 01 Apr, 2025

Also known as cost consultants, quantity surveyors ensure building projects remain within budget. They provide cost and material estimates, draw up projected budgets, and work alongside a team, ...
quality managementquantity analysisquantity surveyingquality assurancequantity estimationquality control

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

Warehouse Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad 01 Apr, 2025

Responsibilities and Duties Preparing documents related to dispatch such as invoices, shipping-labels, picklists etc Picking products from the warehouse for each batch Getting the products packed...
transportwarehouse managementlogistics managementwarehouse clerkpacking materialslogistics freight station warehousingwarehouse managersupply chainswarehouse logistics

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Project Supervisor
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Agartala, Mumbai City, 01 Apr, 2025

We are looking for a responsibleSupervisorto oversee the workflow at our facilities. The role is acomplex one. He/She will not just be someone who supervises the work of others. ...
project managementtechnical skillscontract managementconstruction managementquality assurance

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Hotel cashier
Addon Jobs 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Welcoming customers, answering their questions, helping them locate items, and providing advice or recommendations. Candidate will needed cashier experience for hotel field. Operating scanners, ...
Cashiering

Financial Controller
GF HOTELS AND RESORTS 10.00 to 14.00 Years Other Kerala 01 Apr, 2025

Responsibilities Maintaining internal controls over financial reporting Presenting financial reports to an executive team Overseeing the preparation of budgets Managing accounting records Eva...
Financial reportingBudget preparationRisk managementRegulatory complianceFinancial statementsFinancial reportsAccounting records managementFinancial data analysisAuditing processes coordination

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Sales Executive
MNR Solutions Pvt Ltd 1.00 to 6.00 Years Kochi,Chennai, Lucknow, Navi Mumbai, Vishakhapatnam, Mumbai City, Chandigarh 01 Apr, 2025

Role Description

Develop and execute sales strategies to increase revenue and market share.

Responsible for sales development of microscopes in the region. b2b salessalesmedical equipment salesmedical devices

Immediate Vacancies for Electrical Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Job Description Electrical Engineer Educational Qualification: BE / B.Tech in Electrical Job Types : Fresher, Experienced Salary : Rs.25,000/- to 50000/- Responsibilities: Designing, maintain...
electrical maintenancecontrol paneltransformersswitchgearautomation

Urgent Hiring for Civil Engineer Fresher
Karnataka Information Solution 0.00 to 4.00 Years Kochi,Bangalore, Chennai, Hyderabad 01 Apr, 2025

Description Qualification : BE / BTech Civil Job Types: Full-time, Fresher, Experienced Salary: 25,000.00 - 50,000.00 per month Manage, design, develop, create and maintain projects Conduct o...
civil constructioncivil designconstruction siteconstruction drawingsautocadconstruction safetysite engineeringconstruction estimatingcost estimation

Audit Manager
M/S B NANDI 14.00 to 24.00 Years Delhi,Noida, Oman, Itanagar, South America, Saudi Arabia, Kuwait, Mauritius, Bangalore, Philippines, 01 Apr, 2025

We are looking for an organized, analytical auditor to help us examine our current policies and procedures and help us develop strategies to improve our internal control systems. The Auditor will...
examinationdocumentationinformation processingevaluationauditory processingreportinganalyze information

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Delhi,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates, Hy 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Delhi,Bangalore, Cuttack, Hyderabad, Amritsar, Jalandhar, Pune, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Administrative Manager
Institute of Selection 5.00 to 10.00 Years Delhi,Mathura, Agra 01 Apr, 2025

Job Title: Assistant ADMIN Manager Location: Chhata, Mathura Department: P&&A Reports To: P&&A Manager Salary: INR 30,000/- to 50,000/- Job Summary The Admin Manager is responsible for overseeing...
budgetprocurementnegotiationpricing strategycoordination

Mechanical Engineer
ATOVITT SERVICES PRIVATE LIMITED 4.00 to 9.00 Years Delhi,Noida, Ethiopia, Bangladesh, Anantpur, Bangalore, Chennai, Hyderabad, Kolkata, Gurugram, Pune, 01 Apr, 2025

We are looking for a creative Mechanical Engineer to work on all product stages from research and development to design and manufacture, through to installation and final commissioning.The goal i...
thermodynamicsoptimizationfluid mechanicstroubleshootingmachine designadaptabilitystructural analysisquality assurancematerial science

Workforce Management Consultant
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 8.00 to 10.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

Designation: Workforce Management Consultant Experience Required: 8 years Work Mode: WFH Key Responsibilities: kronos timekeepingkronos wfcwfmsap hrpro

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Gurugram, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

PREV
NEXT

drafting reports Job Openings

Job brief

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod... goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer