executing employee engagement events jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

executing employee engagement events Job Openings

Showing 10701 - 10750 of 27765 Jobs

Pharmacovigilance Associate

CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Roles and Responsibilities

Adverse event collection and reporting: Receiving and reviewing adverse event reports fro...
argus safetyarisgdrug safety

Pre Sales Executive

DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:

Experience Required:

Location: presalestele sales

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Assistant Teacher in DAV
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Gwalior,Indore, Bhopal, Nashik, Bhubaneswar, Cuttack, Rourkela, Fatehgarh Sahib, Ferozpur, Hoshiarpu 01 Apr, 2025

We are seeking an experienced and dedicated preschool teacher to join our team. The successful candidate will be responsible for creating a safe and nurturing learning environment fo...
educational consultingteacher trainingeducation reformteacher mentoringteacher evaluation

Chat Support Executive
JDM CONSULTANCY 1.00 to 5.00 Years Gurugram,Delhi 01 Apr, 2025

Dear Candidate, We have Urgent Hiring for Chat Executive in IGT Solutions : Roles and Responsibilities : _Develop and implement e-commerce st...
chat processnon voicecustomer servicebpoemailemail processchatbackend operations

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Deputy General Manager Finance & Accounts
Employee deal consultants Hiring For A reputed Ready-made Garment Export House 18.00 to 25.00 Years Gurugram,Delhi 01 Apr, 2025

A reuputed Readymade garment manufacturing company is hiring Deputy General Manager Accounts. Looking for a candidate with preferably 20 years of experience. Out of which 10 years minimum should ...
balance sheet finalisationaccounts finalisationtaxationbank limit

Sr HRBP Associate -Gurugram
MEGMA SERVICES 3.00 to 6.00 Years Gurugram 01 Apr, 2025

Leading engineering and construction company requires Sr HRBP Associate - Gurugram One of our client luxury brand which is Indias leading manufacturer of premium doors, windows, wood house and t...
hr operationshrbpassociate

Manager Hrd
Employee deal consultants Hiring For A Reputed Readymade Garment Export House 15.00 to 25.00 Years Gurugram 01 Apr, 2025

A reputed garment export House is looking for a HR Head. The company has 3 units in Gurugram . HR Officers in all units will be gradualy reporting to him. The opening is based in Head Office and ...
hr compliancelabour lawshr generalist activitieslabour welfare

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Project Supervisor
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 18.00 Years Thiruvanananthapuram,Bangalore, Chennai, Noida, Hyderabad, Kolkata, Gurugram, Agartala, Mumbai City, 01 Apr, 2025

We are looking for a responsibleSupervisorto oversee the workflow at our facilities. The role is acomplex one. He/She will not just be someone who supervises the work of others. ...
project managementtechnical skillscontract managementconstruction managementquality assurance

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Kochi,Kollam, Thiruvanananthapuram, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Field Marketing Manager
LEADERS GROUP 2.00 to 6.00 Years Kannur,Other Kerala 01 Apr, 2025

Were Hiring: Field Marketing Manager Are you a results-driven marketer who loves on-ground activations and outreach Join our team as a Field Marketing Manager and lead impactful marketing campai...
Offline MarketingEvent ManagementBrand AwarenessLead GenerationTeam ManagementCampaign AnalysisCommunication SkillsRelationship BuildingSponsorship ManagementPartnership BuildingBTL ActivitiesDatadriven

E2E CNX Architect / CNX Solution Architect
Infosys Limited 4.00 to 8.00 Years Other Kerala,Thiruvananthapuram 01 Apr, 2025

Key Responsibilities: A day in the life of an Infoscion As part of the Infosys consulting team your primary role would be to lead the engagement effort of providing high quality and value adding...
AWSDevOpsGoogle Cloud PlatformKubernetesTelecomSDLCAgile MethodologiesProject ManagementTeam ManagementAgile CoachBusiness Analyst

Creative Strategist
Samagra Progressive Learning Solutions Pvt Ltd 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

Samagra Progressive Learning Solutions Private Ltd is the brainchild of Madhu Bhaskaran, a renowned Business Strategist and HRD trainer. We aim to create a sense of total revamping in the lives of...
Market ResearchContent CreationCommunity EngagementCampaign ManagementBrand AwarenessLead GenerationVideo ProductionSocial Media StrategySocial Media Analytics

Outreach Officer
Malaibar Foundation for Research and Development 1.00 to 5.00 Years Kozhikode,Other Kerala 01 Apr, 2025

Company Description Malaibar Foundation for Research and Development is a non-profit organization dedicated to Research, Training, Publication, and Heritage Preservation in various core areas. Th...
Community EngagementCommunity OutreachCommunicationEvent ManagementResearchInterpersonal Skills

Admin Executive
MUTHOOT HONDA 2.00 to 6.00 Years Other Kerala 01 Apr, 2025

Providing assistance to the HR team in recruitment and onboarding. Providing support in ABS-wide (asset-backed securities) projects. Managing calendar as well as associated operations. Other tas...
RecruitmentOnboardingCalendar ManagementTravel PlanningAdministrative SupportAssetbacked securitiesDocumentation PreparationMeeting Organization

Creative Content Creator & Presenter
Royal Trading Co (Utsav) 2.00 to 6.00 Years Kochi,Other Kerala 01 Apr, 2025

We are looking for a female Content Creator & Presenter to develop, present, and publish engaging video content across social media platforms. The ideal candidate should have a strong on-camera ...
Content CreationVideo EditingSocial MediaCreativityStorytelling

Finance Administration Analyst
ASSETCARE SERVICES PRIVATE LIMITED 1.00 to 5.00 Years Kottayam,Bangalore, Chennai, Ghaziabad, Hyderabad, Kolkata, Gurugram, Faridabad, Mangalore, Ahmedaba 01 Apr, 2025

Financial Management Analysts examine budget estimates for completeness, accuracy, and conformance with procedures and regulations. Analyze budgeting and accounting reports. Afinancial analyst tr...
analysissoftwareaccountingdataexcelcommunicationcollaborationmodelingspreadsheetfinancialmathematical

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Delhi,Gurugram 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Delhi,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates, Hy 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Regional sales director- Reasl estate and project sales
MEGMA SERVICES 10.00 to 20.00 Years Delhi,Noida, Gurugram 01 Apr, 2025

Leading Engineering and construction company requires Regional sales Director( Real estate) - Dehi/ Gurugram/Noida We are looking out for Regional sales director ( Real estate and Project sales)...
project salesdirector salesregional sales manager

Female Fresher School Teacher in DPS Public School
RENOVISION TECHNOLOGY 0.00 to 1.00 Years Delhi,Bangalore, Cuttack, Hyderabad, Amritsar, Jalandhar, Pune, Dalhousie, Vadodara, Guwahati 01 Apr, 2025

Key Responsibilities:

teacher trainingeducational consultingteachingschool teacherteacherclass teacher

Administrative Manager
Institute of Selection 5.00 to 10.00 Years Delhi,Mathura, Agra 01 Apr, 2025

Job Title: Assistant ADMIN Manager Location: Chhata, Mathura Department: P&&A Reports To: P&&A Manager Salary: INR 30,000/- to 50,000/- Job Summary The Admin Manager is responsible for overseeing...
budgetprocurementnegotiationpricing strategycoordination

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

ICICI Bank Aspire Program
ICICI Bank Ltd 0.00 to 1.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City 01 Apr, 2025

About the Company ICICI Bank Ltd, is one of Indias leading private bank offering a wide range of financial services. Established in 1994, it is headquartered in Mumbai and has ...
salesrelationship managementmanagement

Account Management Director
SPENTO PAPERS (INDIA) LLP 12.00 to 22.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Tadepalligudem, Mumbai City 01 Apr, 2025

We are seeking an experienced Account Management Director to lead and optimize our Account Management team. This leadership role will focus on driving customer success and revenue growth, ensuri...
medicaresalesservicemedicaidcustomerbusinessdevelopmentoversightprocessimprovement

Chief Talent Officer
SPENTO PAPERS (INDIA) LLP 25.00 to 0.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Kolkata, Pune, Mumbai City, Itanagar 01 Apr, 2025

We are looking for a Chief Talent Officer who will support our talent acquisition and development activities. You will implement regular performance evaluations and be in charge of our employees...
engagementeeosystemhrispayrolldevelopmentorganizationplanningemployeesuccessionexcellentworkforceinterpersonalstrategic

Management Representative
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Delhi,Bangalore, Chennai, Bhagalpur, Hyderabad, Kolkata, Gurugram, Mumbai City, Anantpur, Ahmedabad 01 Apr, 2025

Managers ensure that their assigned department, store, or district is well staffed and provisioned, adheres to quality and service standards, increases revenue and market share, and helps the bus...
qualitycollaborationdecision-makingmanagementcommunicationleadershipproblemsolvingdelegationproject

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Delhi,Faridabad, Ghaziabad, Gurugram 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Engineering Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 11.00 to 21.00 Years Delhi,Faridabad, Noida, Bhagalpur, Chandigarh, Bhillai, Patna, Muzzafarpur, Korba, Ahmedabad 01 Apr, 2025

We are seeking a highly skilled and experienced Engineering Manager to join our team. In this role, you will be responsible for leading and coordinating multiple projects across diverse teams. Yo...
engineeringground improvementconstruction engineeringpavement engineeringearned value management

Business Development Manager
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 8.00 to 12.00 Years Delhi,Noida, Bangalore, Chennai, Hyderabad, Gurugram, Pune, Mumbai City 01 Apr, 2025

Key Responsibilities:

Strategic Planning: Develop and execute strategic business development plans that align with company goals and target ma...
sales growthanalysismarket analysisadaptabilityadministration workmarketcommunicationstrategic planningstrategic thinkinginnovationnegotiationcontractsresearch

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Delhi,Bangalore, Kochi, Chennai, Hyderabad, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Product Manager
uEngage 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Role Overview We are seeking a dynamic and results-driven Product Manager to join our team in Chandigarh. As a Product Manager, you will own the product lifecycle, from ideation to execution, and...
Product ManagementMarket ResearchStakeholder ManagementQuality AssurancePerformance MonitoringUserCentered Design

Quality Assurance Analyst
Emerson 1.00 to 5.00 Years Chandigarh 01 Apr, 2025

Job Description Job Summary The Quality Assurance Analyst will test web-based applications and API used by our employees and customers. They will provide support to end-users in the organization...
Quality AssuranceTestingAPISoftware ApplicationsTest CasesSystem IntegrationRegression TestingPerformance TestingCustomer ServiceBug TrackingMicrosoft TechnologiesCommunication SkillsOrganization SkillsInterpersonal SkillsAgile ScrumSQLAut

Digital Marketing Intern
Momade Miracles 0.00 to 4.00 Years Panchkula,Other Haryana 01 Apr, 2025

Market research: Collecting data to identify target audiences, new markets, and campaign success Content creation: Writing marketing materials like blog posts, social media posts, press releases,...
Market researchContent creationCampaign executionSocial media

Research Fellow
Cyber Security Academy Southampton 3.00 to 7.00 Years Chandigarh 01 Apr, 2025

Palliative Care Trial Southampton Clinical Trials Unit, Faculty of Medicine Overview Southampton Clinical Trials Unit (SCTU) is seeking a highly motivated Research Fellow join the INDIGO study ...
Qualitative researchData collectionData analysisWritten communicationOral communicationGood Clinical PracticeOrganisational skillsProblemsolvingPersonBased ApproachIntervention development

Apprentice Trainee, Payroll
Oceaneering 0.00 to 3.00 Years Chandigarh 01 Apr, 2025

Company Profile Overview Since year 2003, Oceaneerings India Center has been an integral part of operations for Oceaneerings robust product and service offerings across the globe. This center ca...
Microsoft Office SuiteVerbalwritten communications

Do work from home, Data Entry Executive work
Aspect Solution 0.00 to 1.00 Years Chandigarh,Bangalore, Chennai, Kasargod, Vellore, Kolkata, Pune, Kakinada, Mangalore, Other Karnatak 01 Apr, 2025

Dear employee , were seeking a skilled data entry operator to join our data team. Position: Fresher /Backed office /Computer Operator/ Data Entry Operator skills needed: basic computer knowled...
back officetypingexcel

PREV
NEXT

executing employee engagement events Job Openings

Key Responsibilities:

Key Responsibilities:

Key Responsibilities:

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers