Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

fema matters Job Openings

Showing 0 - 50 of 2746 Jobs

Administrative Associate

AWINMO INDIA MARKETING PRIVATE LIMITED 1.00 to 10.00 Years Pune, CanadaCanada, Zimbabwe, Mozambique, Bangalore, Chennai, Noida, Hyderabad, Gurugram, Kolkata, M 20 Aug, 2026

Assistant Manager-Client Support & Commercial Operation (Nagpur)

Straive 1.00 to 10.00 Years Nagpur 20 Aug, 2026

distributed team management

customer success

data fluency

CSAT improvement

Senior Accounts & Finance Executive

PanScience Innovations (PSI) 1.00 to 10.00 Years Nagpur 20 Aug, 2026

Business Development Officer - Used Commercial Vehicle Finance

Equitas Small Finance Ltd 1.00 to 10.00 Years Mangalore 20 Aug, 2026

sales

business development

finance

relationship management

Business Development Officer - Used Commercial Vehicle Finance (Mangalore)

Equitas Small Finance 1.00 to 10.00 Years Mangalore 20 Aug, 2026

Business Development

Customer Relationship Management

Fundraising Executive

OVERNET TRADING PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, BangaloreBangalore, China, Australia, Meerut, Patna, Saudi Arabia, Cuddalore, Kalyan, Mya 20 Aug, 2026

Manager HRBP

T3COGNO PRIVATE LIMITED 1.00 to 10.00 Years Chennai 20 Aug, 2026

Job Description Manager HR Business Partner (HRBP)

Position: Manager HRBP

Domain-BPO/KPO

Job Summary

Ma...
human resourcesemployee engagementpoliciesemployee retentionpms performance managementemployee connectemployee engagement employee retention / rag

Lending Operations Manager
GrayQuest 1.00 to 10.00 Years Mumbai City 17 Aug, 2026

Role Overview The Operations Manager Lending Operations will be responsible for managing end-to-end disbursement operations across GrayQuests Retail and Institutional lending portfolios - spanni...
Analytical SkillsExcelBI ToolsComplianceStakeholder ManagementDashboardsOperational LeadershipAI ToolsLending Operations

Senior Operations Manager Chemical Tanker (Based in Mumbai, India)
Nameless 1.00 to 10.00 Years Mumbai City 17 Aug, 2026

Our client is a leading shipping MNC with a global presence. To support their management leadership team and manage operations, our client is hiring Senior Operations Manager Chemical Tanker in S...
cargo handlingvettingISMISPSleadershipcommunicationstakeholder engagementchemical tanker operationsMLC codes

Manager - Digital Marketing Analytics
Roche 1.00 to 10.00 Years Hyderabad 17 Aug, 2026

At Roche you can show up as yourself, embraced for the unique qualities you bring. Our culture encourages personal expression, open dialogue, and genuine connections, where you are valued, accept...
ConsultingAdobe AnalyticsAttribution ModelingSEOSEMSocial MediaDigital Marketing AnalyticsMartechAdobe CJA

HR Operations ITES (Jabalpur)
Happy Square Outsourcing Services 1.00 to 10.00 Years Jabalpur 17 Aug, 2026

- Manage and coordinate HR operations, including recruitment, employee data management, and perks administration. - Develop and implement effective HR policies and procedures to ensure complianc...
HR operationsrecruitmentemployee data managementHR policiescomplianceonboardingtrainingperformance managementcollaboration

HR Coordinator
VR Automation 1.00 to 10.00 Years Mumbai City 17 Aug, 2026

HR Executive Job Location: Pirangut, Pune Experience: 25 Years Employment Type: Full-time Industry: Automobile / Manufacturing Qualification: Graduate / BBA / B.Com / BA Preferred Qualification: ...
RecruitmentPayrollAttendance ManagementStatutory ComplianceEmployee RelationsHRMSESIC

Data Analyst ( Data Science ) Chennai, Tamil Nadu, India
Arcadia Power, Inc 1.00 to 10.00 Years Chennai 17 Aug, 2026

Level: L2 Data Analyst Location: India (remote/hybrid) Trusted by Fortune 2000 companies, Arcadia combines unified data, AI-powered analytics, and expert advisory to help enterprise teams save ...
PythonSQLData AnalyticsData ScienceStatisticsData CleaningData TransformationData ValidationExploratory Data Analysis

Remote PartTime Data Scientist Multimodal Foundation Model Evaluation & Data
vmysmartpros 1.00 to 10.00 Years All India 17 Aug, 2026

```html About arenaflex Pioneering the Future of Intelligent Computing arenaflex is a global leader in cuttingedge technology, delivering innovative hardware, software, and services that empower ...
PythonMachine LearningDeep LearningData ScienceStatistical AnalysisData EngineeringBenchmarkingCollaborationModel Evaluation

Business Insights & Analytics Associate Director, Data Science
Lilly 1.00 to 10.00 Years Bangalore 17 Aug, 2026

At Lilly, the work is demanding because patients are waiting. We unite caring with discovery to help make life better for people around the world, knowing that every decision, every detail, and ev...
Data SciencePeople ManagementPharmaAnalyticsCommunicationInterpersonal SkillsProject ManagementData AnalyticsPredictive Analytics

Full-Stack AI Engineer / Data Scientist Agentic Systems
6221 Roche Information Solutions India Private Limited 1.00 to 10.00 Years All India 17 Aug, 2026

At Roche you can show up as yourself, embraced for the unique qualities you bring. Our culture encourages personal expression, open dialogue, and genuine connections, where you are valued, accepte...
Data SciencePythonAWSAIML engineeringgenerative AIMLOpsTypeScriptLangChainmulticloud

Full-Stack AI Engineer / Data Scientist Agentic Systems
Roche 1.00 to 10.00 Years Hyderabad 17 Aug, 2026

At Roche you can show up as yourself, embraced for the unique qualities you bring. Our culture encourages personal expression, open dialogue, and genuine connections, where you are valued, accept...
Data SciencePythonDatabasesDockerTypeScriptCloud PlatformsAPI design

Customer Service Representative US Healthcare Voice Process (Chennai)
Earning Curve Chennai 1.00 to 10.00 Years Chennai 17 Aug, 2026

Job Details - Role: Customer Service Representative US Healthcare - Location: Chennai - Shift: US Night Shift (MondayFriday) 6PM to 3AM - Employment Type: Full-Time. Ready to Start Your Next Car...
verbal communicationinterpersonal skillsappointment schedulingdocumentationcollaborationlistening skillsproblemsolvingempathyprofessionalism

Dynamic Inside Sales & Customer Service Representative B2B Construction
vmysmartpros 1.00 to 10.00 Years All India 17 Aug, 2026

About arenaflex Pioneering Engineered Wood Solutions arenaflex is a marketleading manufacturer of engineered wood roof and floor trusses, serving residential, commercial, and agricultural constru...
Communication SkillsERPBuilding CodesCustomer Service ExcellenceOrganizational MasteryAdvanced Microsoft Office SkillsSelfMotivationInitiativeTechnical AcumenCRM systems

Customer Service Representative US Healthcare Voice Process
Earning Curve Chennai 1.00 to 10.00 Years Chennai 17 Aug, 2026

Job Details Role: Customer Service Representative US Healthcare Location: Chennai Shift: US Night Shift (MondayFriday) 6PM to 3AM Employment Type: Full-Time. Ready to Start Your Next Career Chap...
verbal communicationinterpersonal skillscustomer serviceappointment schedulingdocumentationlistening skillsproblemsolvingempathy

Remote German Speaking Customer Service Representative Work From Home
vmysmartpros 1.00 to 10.00 Years All India 17 Aug, 2026

Join arenaflex as a Remote German Speaking Customer Service Representative Deliver Exceptional Support from Anywhere Are you a native German speaker with a passion for helping others and a talen...
Customer serviceCommunication skillsTeamworkAdaptabilityGerman speakingEnglish fluencyActive listeningProblemsolvingSales skills

Software Development Intern
Lenskart 1.00 to 10.00 Years Hosur 17 Aug, 2026

Start your career in software engineering with Lenskart as a Software Development Intern in Hosur. You will sit with a working team, use the same tools and systems they do, and own a defined piece...
JavaPythonSQLUnit TestingDebuggingData StructuresAlgorithmsObjectOriented ProgrammingREST APIsGitGitHub

AVP - Scrum Master Software Engineering - Platform Modernization
LPL Financial Global Capability Center 1.00 to 10.00 Years All India 17 Aug, 2026

At LPLs Global Capability Center, youll find a collaborative culture where your voice matters, integrity guides every decision, and technology fuels progress. Your skills, talents, and ideas will ...
ScrumSoftware developmentMicroservicesAgile project managementJiraAzure DevOpsAgile practicesAgile transformations

Software Engineering Team Lead
vmysmartpros 1.00 to 10.00 Years All India 17 Aug, 2026

Join our growing FinTech Engineering team! Were recruiting a Software Engineering Team Lead to spearhead the delivery of our new loan origination architecture, compliance systems, and pricing plat...
NETAzureAWSGCPKafkaRabbitMQeventdriven architecturemicroservice development

Software Engineering Intern
EdZola 1.00 to 10.00 Years Coimbatore 17 Aug, 2026

We are hiring our next batch of full-time Software Engineering Interns at EdZola for our Coimbatore office. This hiring cycle feels particularly important to me. Over the last few years, I have ha...
Software EngineeringTechnologyProblem SolvingAPIsDatabasesDashboardsAI ProductsZoho Applications

Urgent Hiring HR Generalist (Female) for Kondhwa , Pune
AHS Corporate Services Pvt Ltd 1.00 to 10.00 Years Pune 14 Aug, 2026

Recruitment & Onboarding Manage end-to-end hiring: JDs, sourcing, screening, offer letters, agreements, induction, ID issuance, and verification formalities.

Exit & Offboarding...
performance managementkrarecruitmentkpi

Accountant TDS & GST
Global Services 1.00 to 10.00 Years Navi Mumbai, Mumbai City 14 Aug, 2026

We are hiring 10 Accountants each for Lower Parel & Vashi locations. Candidates must be graduates with strong experience in TDS & GST compliance...
gstfinalisationprofessional taxaccountingincome taxroc compliancetdsesic compliance

Tax Specialist
SV PROFESSIONAL CORPORATE SERVICES PRIVATE LIMITED 1.00 to 10.00 Years Hyderabad 14 Aug, 2026

What roles and responsibilities will be performed by the selected candidate

Act as a senior technical tax advisor for the Expat team, aligned to the scope currently s...
irstaxcpa

Executive Assistant
Big Bee Consultant 1.00 to 10.00 Years Delhi 14 Aug, 2026

We are looking to hire a Female Executive Assistant / Personal Assistant for the Vice Chairmans Office for our corporate office, New Delhi. We are looking for a young, dynamic and highly profess...
pr managementcorporate communicationcoordinationproactive monitoringpersonal assistanceexecutive assistant

Senior Manager HR Business Partner | South India HRBP | Hospitality
Fyndbridge Consulting Services 1.00 to 10.00 Years Chennai 14 Aug, 2026

About the Opportunity Our client is a leading and professionally managed organization with a significant presence across commercial and premium assets in India. As part of its continued growth and...
Workforce PlanningOrganization DesignTalent ManagementSuccession PlanningPerformance ManagementEmployee EngagementEmployee RelationsLeadership DevelopmentRetention

R2R Analyst
CKPL Consulting Krew Private Limited 1.00 to 10.00 Years Chennai 14 Aug, 2026

Job Position: Finance R2R Analyst Location: Chennai Shift Time: 4AM to 1PM (AUS Timezone) Experience: 10 years of relevant experien...
sapr2r

Fundraising Executive
OVERNET TRADING PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, BangaloreBangalore, China, Australia, Meerut, Patna, Saudi Arabia, Cuddalore, Myanmar, Ka 06 Aug, 2026

Manage and lead operations and compliance of fund-related activities To liaise with various regulators and consultants to maintain compliance with the funds Interact and lead the investor sign-u...
deal strategybuyoutsrecapitalizationsdeal sourcingdeal creationfund transferdeal executionsubordinated debtfinancial sponsors

Fundraising Executive
OVERNET TRADING PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, BangaloreBangalore, China, Australia, Meerut, Patna, Saudi Arabia, Cuddalore, Myanmar, Ka 06 Aug, 2026

Manage and lead operations and compliance of fund-related activities To liaise with various regulators and consultants to maintain compliance with the funds Interact and lead the investor sign-u...
deal strategybuyoutsrecapitalizationsdeal sourcingdeal creationfund transferdeal executionsubordinated debtfinancial sponsors

Fundraising Executive
OVERNET TRADING PRIVATE LIMITED 1.00 to 10.00 Years Mangalore, BangaloreBangalore, China, Australia, Meerut, Patna, Saudi Arabia, Cuddalore, Kalyan, Mya 06 Aug, 2026

Manage and lead operations and compliance of fund-related activities To liaise with various regulators and consultants to maintain compliance with the funds Interact and lead the investor sign-u...
deal executiondeal creationfinancial sponsorssubordinated debtdeal sourcingmezzaninebuyoutsdeal strategyfund transfer

Senior Operations Manager (India, Mumbai)
BW LPG 1.00 to 10.00 Years Mumbai City 01 Aug, 2026

Role Summary The Senior Operations Manager oversees vessel operations, drives fleet performance optimization, and improves port turnaround. Responsibilities include managing pre- and post-fixtur...
operations managementprocurementperformance monitoringprocess improvementstakeholder managementdata managementfleet performance optimizationport turnaround

Sr Specialist, Software Development & Engineering - Site Reliability Engineering
Charles Schwab 1.00 to 10.00 Years Hyderabad 01 Aug, 2026

Your opportunity Schwab Description: At Charles Schwab, our purpose is simple: we champion clients goals with passion and integrity. Guided by honesty, mutual respect and a commitment to doing wh...
Production SupportDevOpsSystems EngineeringIncident managementProblem managementChange managementRoot cause analysisSite Reliability EngineeringSRE principles

Intern - Software Engineer - Ultra Low Latency (2028 Graduates) (Gurugram)
graviton research capital 1.00 to 10.00 Years All India 01 Aug, 2026

Software Engineering Intern (Ultra Low Latency) Every nanosecond matters. In high-frequency trading, every optimization, every instruction and every decision can create a measurable competit...
VHDLVerilogThreadingNetworkingBenchmarkingMonitoringCPU architectureMemory hierarchy

Specialist, Software Development & Engineering - AI Devops & Release Engineer
Charles Schwab 1.00 to 10.00 Years Hyderabad 01 Aug, 2026

Your opportunity At Charles Schwab, our purpose is simple: we champion clients goals with passion and integrity. Guided by honesty, mutual respect and a commitment to doing whats right, we bring i...
DevOpsGitHubAnomaly detectionRoot cause analysisAI Site Reliability EngineeringAIaugmented developmentGen AICICD pipelinesDeployment automation

Specialist - Software Engineering - BPM Technology
Charles Schwab 1.00 to 10.00 Years Hyderabad 01 Aug, 2026

Your opportunity At Charles Schwab, our purpose is simple: we champion clients goals with passion and integrity. Guided by honesty, mutual respect and commitment to doing whats right, we bring inn...
JavaNETAlgorithmsData StructuresDesign patternsSystem designDatabasesNetworkingTestingSecure codingObjectoriented programmingConcurrencyCICDCloud platformsAI agents

Sr Specialist, Software Engineering - BDSE
UNAVAILABLE 1.00 to 10.00 Years Hyderabad 01 Aug, 2026

Your OpportunityAt Charles Schwab, our purpose is simple: we champion clients goals with passion and integrity. Guided by honesty, mutual respect and commitment to doing whats right, we bring inno...
COBOLJCLCICSDB2JavaSpring BootREST APIsCloud Concepts

Field Service Engineer
MEDI TRANSCARE PRIVATE LIMITED 1.00 to 10.00 Years Pune, Kozhikode 28 Jul, 2026

SUMMARY OF THE JOB The FSE is responsible for managing the customer support system in the installation, service and repair of all products supported by Client Company. Responsib...
installationcommunication skillsmedical equipmentfield service

Senior Patent Paralegal/Docketing Professional
Space Consultant 1.00 to 10.00 Years Noida 28 Jul, 2026

Senior Patent Paralegal/Docketing Professional Location- Greater Noida 1. Candidates should have at least 566 years of core experience in all facets of Patent Docketing / Paralegal / Secretary d...
filingdocketing

Vice President - Plant Head
HR JOBS CONSULTANCY 1.00 to 10.00 Years Hyderabad, NeemranaNeemrana, Nashik, Bangalore, Indore, Noida, Navi Mumbai, Gurugram, Pune, Vadodara 28 Jul, 2026

Vice President - Plant Head Key Responsibilities

Drive overall plant performance, productivity, quality and delivery metrics.

Lead contin...
vice presidents

Assistant Manager Finance & Accounts
AVA CHOLAYIL HEALTH CARE PRIVATE LIMITED 1.00 to 10.00 Years Chennai 28 Jul, 2026

JOB DESCRIPTION Designation: Assistant Manager Finance & Accounts - Department: Finance & Accounts Job Content reporting compliance activities. good analytical communication skills.equity investments treasury operations. working knowledge of oracle ebs ms excel for accounting

Cma - Durg (Raipur)
Vinayak Outsourcing Works 1.00 to 10.00 Years Raipur 22 Jul, 2026

Key responsibilities of a Chartered Accountant: - Financial Reporting: Preparing accurate financial statements including balance sheets, income statements, and cash flow statements. - Audi...
Financial ReportingAuditingTax PlanningFinancial AnalysisBudgetingForecastingInternal ControlsCompliance

Business Head
UNITED CARGO LOGISTIC 1.00 to 10.00 Years Noida, DelhiDelhi, Bhutan, Bangladesh, South Africa, Arunachal Pradesh, Bangalore, Chennai, Sri Lank 22 Jul, 2026

We are looking for an experienced Business Manager to lead and oversee the work of employees in our company. You will be responsible for ensuring the efficiency of business operations as well as ...
payrolldevelopmentoperationsperformanceservicebusinesscustomermanagementplanresourcesfinancialtaxeshuman

Plant Safety Manager
TALENTCO HR SERVICES LLP 1.00 to 10.00 Years Navi Mumbai, Mumbai City 22 Jul, 2026

Job Title: Plant Safety Manager
Job Description
The Plant Safety...
risksafetyemergencyhseinvestigationhealthmanufacturingauditassessmentehsindustrialaccidentplantoccupationalmanager

Back Office Executive- LPO (Legal Process Outsourcing)
Wehire Talent Solutions 1.00 to 10.00 Years Mumbai City, Mira Bhayandar 22 Jul, 2026

Job Description LPO (TLG)| Voice & Non-Voice Process Position

Back Office Executive

Non-Attorney Debt Collector

Paralegal Support...
data entryclient communicationms officenon voice processemail supportlegal process outsourcingdebt collectiondocumentationvoice processofficeexecutive

Business Manager
ODH DEVELOPERS PRIVATE LIMITED 1.00 to 10.00 Years Bongaigaon, Purbi SinghbhumPurbi Singhbhum, Lakhisarai, Oman, Gandhinagar, Kuwait, Noida, Chennai, S 22 Jul, 2026

We are looking for an experienced Business Manager to lead and oversee the work of employees in our company. You will be responsible for ensuring the efficiency of business operations as well as ...
timebudgetingcommunicationproblemleadershipmanagementorganizationalsolvingskills

Business Manager
ODH DEVELOPERS PRIVATE LIMITED 1.00 to 10.00 Years Gandhinagar, OmanOman, Kuwait, Sudan, Malaysia, Mumbai City, Jordan, Kenya, Egypt, Indonesia, Purbi 22 Jul, 2026

We are looking for an experienced Business Manager to lead and oversee the work of employees in our company. You will be responsible for ensuring the efficiency of business operations as well as ...
timebudgetingcommunicationproblemleadershipmanagementorganizationalsolvingskills

NEXT

fema matters Jobs

fema matters Job Openings

Job Description Manager HR Business Partner (HRBP)

Position: Manager HRBP

Domain-BPO/KPO

Job Summary

Job Description

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers