financial statements expertise jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

financial statements expertise Job Openings

Showing 17501 - 17550 of 43353 Jobs

Required SEO, IT-Business Analyst, Andoid and IOS Application Developer.

Orion Infosolutions 0.00 to 3.00 Years Jaipur,Other Rajasthan 01 Apr, 2025

SEO

ITBusiness Analyst

Andoid

HIRING FOR AGENCY MANAGER

RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 3.00 to 8.00 Years Jaipur,Nashik, Pimpri Chinchwad, Mumbai City, Surat, Mehsana, Ahmedabad 01 Apr, 2025

agency development

agency channel

Territory Manager

Headsbase Consultancy 3.00 to 8.00 Years Jaipur,Mumbai City, Surat, Ahmedabad 01 Apr, 2025

There is Urgent Opening of Territory Managerfor Retail & HNI business.

Locations: Mumbai- Thane, Goregaon, Badlapur, Jaipur ,Gujarat Surat, Ahmedabad

...
agency saleslife insuranceinsurance salesinsurance brokinginsurance team handlingcda channel

Hiring Recruitment Development Manager (RDM) Life Insurance Sales Agency
Niyukti Management Consultants Hiring For Niyukti Management Consultants 4.00 to 9.00 Years Jaipur,Noida, Delhi, Udaipur, Varanasi, Kanpur, Lucknow, Gurugram, Amritsar, Ludhiana 01 Apr, 2025

Job Opening: Recruitment Development Manager (RDM) Life Insurance Sales Agency Position: Recruitment ...
channel partnersagency saleschannel salessalesdirect salesbancassuranceagency channeltied channelchannel sales development

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Jaipur,Delhi, China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, United Arab Emirates, Hy 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Financial Analyst
Divya Staffing Solution 0.00 to 4.00 Years Jaipur,Jodhpur, Udaipur, Canada, Singapore, Oman, Indore, United Arab Emirates, Raipur, Pimpri Chinc 01 Apr, 2025

We are looking for a Financial Analyst responsible for analyzing financial data and supporting budgeting efforts, including preparing financial reports, monitoring financial trends, and making re...
analyticscriticality analysisoperationsanalysis

gold loan Field Sales Manager
MONEYLICIOUS INVESTMENTS AND CONSULTING SERVICES PRIVATE LIMITED 2.00 to 4.00 Years Jaipur,Delhi, Bangalore, Lucknow, Hyderabad, Kolkata, Mumbai City, Ludhiana, Vadodara 01 Apr, 2025

URGENT HIRING Requirement for Sales Manager in gold loan company Job Title: Sales Manager Education: Bachelors degree required (Graduation) Experience: 2 years of B2C field sales experience i...
gold loanfield salesfield workgold loan valuation

Sales Manager (Forex & Comex)
Signal Expert Global 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Job Profile Manager Sales (Forex & Comex) / Full Time / Permanent / Work From Office Package will depend on the interview Roles and Responsibilities Responsible for achieving both individual ...
Cold CallingSales StrategiesRelationship ManagementSalesMarketing SkillsGlobal Market Knowledge

Head Chef
Sahastra Foods And Services PVT LTD 5.00 to 9.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Role Overview: The Head Chef at Adams Ale is responsible for leading the kitchen team, managing culinary operations, and ensuring the delivery of high-quality food. The role involves menu developm...
Menu DevelopmentStaff ManagementInventory ManagementCost ControlCustomer SatisfactionLeadership SkillsTime ManagementCommunication SkillsInterpersonal SkillsHealthSafety RegulationsCollaboration with ManagementOrganizational Skills

Assistant Plant Manager
Human Matrix 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Human Matrix Securite is Indias most professional & technology-driven Integrated Facilities & Waste Management Services Company based in Indore. We offer tailor-made solutions...
Plant ManagementPlant OperationsOperations ManagementProduction PlanningManufacturing OperationsLeadership Skills

Finance Associate
Intent 2.00 to 6.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Company Description Welcome to Intent! We are a global fractional finance company. Our mission is to empower global startups with scalable finance systems that save time, effort, and money. We un...
XeroQuickBooksMicrosoft Excel

Database Management Executive
Cibirix Inc 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

Cibirix is hiring for Database Management Executive Experience - 3 Years to 4 Years Location- Indore, MP (Work From Office) Role & Responsibility:- Oversee the collection, processing, and anal...
Data ManagementData AnalysisDatabase DesignData ModelingData VisualizationBusiness StrategyPrivacy RegulationsAnalytical SkillsCommunication SkillsInterpersonal SkillsProject ManagementData Protection

Interior Designer in Indore, Ujjain, Bhopal (Hybrid)
SKYLine BUILT 3.00 to 7.00 Years Indore,Other Madhya Pradesh 01 Apr, 2025

As an interior designer at SKYLINE BUILT, you will have the opportunity to showcase your creativity and technical skills in designing cutting-edge spaces for our prestigious clients. Utilizing you...
Google SketchUpAdobe PhotoshopAutoCADAutodesk 3ds Max

Opening Senior Accountant
TALENT MAX HR & MANGAGEMENT CONSULTANT 10.00 to 15.00 Years Indore 01 Apr, 2025

Job Opening: Senior Accountant Location: Pithampur Experience: income tax actaccounting standardsdirect tax

Equity Research Analyst
Jobsense 1.00 to 3.00 Years Indore 01 Apr, 2025

We are a hardcore research, analytics provider. Started building a track record of growth, a culture of innovative solutions which sets us apart. We are delivering our opinions, actionable insigh...
fundamental analysisequity valuationequity researchqualitative analysisfinancial modelingequity analysis

Relationship Manager
DREAMS SOLUTIONS 0.00 to 3.00 Years Indore 01 Apr, 2025

We hiring For Relationship Manager And Advisor For -INDORE/ NOIDA/ MUMBAI Experince-6 Month to 2 year Key Responsibilities...
salesdirect marketingdemat accounts

Payroll Coordinator
M/S B NANDI 10.00 to 20.00 Years Hyderabad,China, Qatar, South Africa, Tambaram, Bhubaneswar, Bangalore, Jaipur, United Arab Emirates 01 Apr, 2025

We are looking for a payroll coordinator to manage all payroll activities and ensure the timely and accurate payment of employee wages. The payroll coordinator will ensure the collection of all n...
transfer pricing analysisbenefitsrecord keepingpromotionspayroll managementpaychex

Area Sales Manager
Transformatrix Global Private Limited 6.00 to 11.00 Years Hyderabad 01 Apr, 2025

Were Hiring! Area Sales Manager (Electronic Components) Were looking for an Area Sales Manager to join our Hyderabad Office. This is an excellent opportunity for those who want to grow their car...
salesbusiness developmentindustrialelectronics

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Hyderabad,Bangalore, Chennai, Vijayawada, Gurugram, Pune, Mumbai City, Delhi 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Regional Sales Manager-Project sales( construction chemicals)
MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Male Front Office - MEHEDIPATNAM, KPHB
AURA HEARING CARE PRIVATE LIMITED 1.00 to 4.00 Years Hyderabad 01 Apr, 2025

To welcome & Assist Customer on their arrival in clinics.

Take down customers details and information. (Forms and official Templates to be filled).

Confir...
cash receiptsms officeinvoice processingbillingpetty cash

Farm Supervisor
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Bangladesh, Chirang, Guwahati, Bangalore, Bhagalpur, Chennai, Nagaon, Sivasagar, Pune, Dhu 01 Apr, 2025

We are searching for a manager with good business sense to join our team. The farm managers responsibilities include monitoring staff, crops, and livestock, purchasing supplies, preparing budgets...
farm equipmentdeerfarmingfarmlandnunchuku skillshunting landbowhuntingfarmers

Structural Engineer
LEADZN PRIVATE LIMITED 10.00 to 20.00 Years Hyderabad,Zimbabwe, Mozambique, Afghanistan, Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mum 01 Apr, 2025

We are seeking a skilled and experienced structural engineer to join our team and take charge of overseeing our construction projects. Your primary responsibility will be to ensure the safety and...
architecturecommunicationanalyticalengineeringdesignproblemmanagementstructuralsolvingprojectcollaborateability

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

Financial Management
M/S AASTHA LIFECARE CORPORATION PRIVATE LIMITED 11.00 to 21.00 Years Hyderabad,Bangalore, Chennai, Kolkata, Gurugram, West Siang, Bhillai, Silvassa, Port Blair, Dibrugar 01 Apr, 2025

A Financial Manager oversees an organizations financial health, creating reports, managing investments, developing financial strategies, and ensuring compliance with regulations, all while advisi...
managementaccountsbusinessstrategyreceivableanalysisaccounting

Head Chef (Industrial Canteen)
MALABAR GOLD LIMITED 5.00 to 10.00 Years Hyderabad,Other Telangana 01 Apr, 2025

Greeting from Malabar!
Job Title : Head Chef ( Industrail Canteen) Experience : 6 years experience Location:Maheshwaram, Telanagana Department<...
kitchen managementmenu planninginventory managementhygienist activitiesindustrial

Pre Sales Executive
DIGITALCUBE CONSULTANCY SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Delhi 01 Apr, 2025

Designation:Pre-Sales Executive Experience Required:6month to 2years Location: presalestele sales

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Hyderabad,Bangalore, Noida, Chennai, Nellore, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Hyderabad,Bangalore, Kochi, Chennai, Gurugram, Kolkata, Kollam, Thiruvanananthapuram, Mumbai City, D 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

Medical Officer
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 10.00 to 17.00 Years Hyderabad,Bangalore, Chennai, Kochi, Noida, Gurugram, Kollam, Thiruvanananthapuram, Mumbai City, Del 01 Apr, 2025

We are seeking a highly capable medical officer to manage our medical team and to supervise the healthcare services that they provide. In this role, your duties will include serving as a clinical...
patient safetydiagnosispatient carecommunication

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Opening for Freelance Recruiter with Talentsphere Management Services
Reema Rai 1.00 to 6.00 Years Gurugram,Delhi, Noida, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Mumbai City, Mangalore 01 Apr, 2025

Greetings from Talentsphere Management Services! I hope youre doing well. We are excited to introduce a fantastic opportunity for you to collaborate with us a...
screening resumesexecutive searchfreelance recruitmentrecruitmentnon it recruitmenttechnical recruitingit recruitment

Urgent | Hiring SME(Ticketing) & SME (Sales) in Delhi & Gurugram
Sharda Consultancy Services 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Noida 01 Apr, 2025

Dear Candidates, We are hiringSME(Ticketing) & SME (Sales) in Delhi & Gurugram SME (Ticketing) - Delhi Salary 40 k depending upon the interview SME (Sales) - Gurugram Salary 55k incentives Pr...
subject matter expertiseteam managementgdsamadeussalesprocesstravel coordinationtravelholiday packagesticketingsme

Sr.Finance Manager
Confidential 10.00 to 15.00 Years Gurugram 01 Apr, 2025

We are Hiring for Senior Finance Manager - SahiBandhu FinTech Services ( The Manipal Group) About Us:- SahiBandhu is Indias leading gold loan platform backed b...
gaapbenefits realisationcash flowrisk managementfinancial analysiserpfinancial reportingstakeholder managementerp software

Accountant
PLACEMENT EXPERT Hiring For Congo DRC 4.00 to 9.00 Years Gurugram,Delhi, Bangalore, Chennai, Hyderabad, Vijayawada, Pune, Mumbai City 01 Apr, 2025

We have a requirement for Accountant with our client which Internet service provider in Kinshasa, Democratic Republic of the Congo. Position: Accountant englishaccounting

Data Modeler Team Lead/Architect
Angel and Genie 7.00 to 10.00 Years Gurugram 01 Apr, 2025

Data Modeler Architect Position: Data Modeler Architect Experience: 8 years Location: Gurugram Department: IT/Data Architecture Reports to: Data Architecture Lead / Data Manager Position Overvie...
big dataawsdata visualizationgcpazure

Marketing Executive
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 14.00 to 24.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Bhagalpur, Hyderabad, Pune, Patna, Guwahati 01 Apr, 2025

Marketing executives coordinate and oversee campaigns geared at promoting products, services, and causes. Marketing executives are adept at a variety of platforms, including print and social med...
marketing researchmarketing communicationmarketing managementbrand managementmarketing

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Accounting Specialist
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 7.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Check figures, postings, and documents for accuracy. Organize, secure, and maintain all files, records, cash and cash equivalents in accordance with policies and procedures. Record, store, access...
qualitystandardsbillingaccountingfinance executivementorsupervisorpayrollfinancial

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Brand Manager
MNR Solutions Pvt Ltd 10.00 to 16.00 Years Gurugram 01 Apr, 2025

Brand Manager Key Responsibilities: Develop and execute comprehensive brand strategies and marketing plans, collaborating with the founders to drive brand growth and strengthen market presence...
brand managementbrand marketingbrand planningbrand campaigns

Plant Engineer
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 12.00 to 22.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Nellore, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for a Plant Manager to drive continuous improvement and optimization of all processes.
Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

NTT DATA Virtual Drive Hedge Fund Gurgaon
NTT DATA INFORMATION PROCESSING SERVICES PRIVATE LIMITED 1.00 to 3.00 Years Gurugram 01 Apr, 2025

NTT DATA is Hiring experienced candidates for Hedge Fund Accounting domain. Location:Gurgaon Sector 48 (Candor Techspace) Work from Office Only Shift ...
reconciliationhedge fundsnav calculationinvestment banking

Hospital Manager
RAV GLOBAL SOLUTIONS PRIVATE LIMITED 13.00 to 18.00 Years Gurugram,Delhi, Bangalore, Kochi, Chennai, Hyderabad, Kolkata, Kollam, Thiruvanananthapuram, Mumbai 01 Apr, 2025

We are looking for an experienced Hospital Administration Manager to run our medical facility. To be successful in this role, you should have a deep understanding of all administrative hospital ...
problemmanagementbudgetingassurancecollaborationcommunicationqualityfinancialsolving

PREV
NEXT

financial statements expertise Job Openings

Greeting from Malabar!

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla... project engineeringprocess equipmentengineering processengineeringplant engineering

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering

Plant Manager Job Duties The Plant Manager will oversee all daily operations of the pla...
project engineeringprocess equipmentengineering processengineeringplant engineering