life insurance agency background only jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

life insurance agency background only Job Openings

Showing 19651 - 19700 of 49078 Jobs

Onroll Interview | Immediate Joining | Relationship Manager- Home Loan Sales

Veerwal Getwork Services Private Limited 1.00 to 6.00 Years Indore,Jaipur, Noida, Ghaziabad, Gurugram, Faridabad, Pune, Delhi 01 Apr, 2025

Sr.RM | RM

sales process

field work

Product Manager

RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Indore,Jabalpur, Gwalior, Bhopal, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Unit Sales Manager

ICICI LOMBARD GENERAL INSURANCE CO LTD 1.00 to 2.00 Years Indore,Nashik, South Goa, Ahmednagar, North Goa, Pune, Nagpur, Other Goa 01 Apr, 2025

Sales Team Coach

ICICI LOMBARD GENERAL INSURANCE CO LTD 3.00 to 8.00 Years Indore 01 Apr, 2025

sales operationsleadership skillsoutbound salesteam handlingtelesalescall center operationstarget achievementverbal communicationsales support

Project Manager

MD Shakeel Ahamed Hiring For ECPS Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

project handling

manager programvendor co-ordination

Hr Executive

H I R E 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Process Associate

STRYDE CONSULTING SERVICES Fresher Hyderabad 01 Apr, 2025

icse

excellent communication

Regional Sales Manager-Project sales( construction chemicals)

MEGMA SERVICES 12.00 to 20.00 Years Hyderabad,Bangalore, Chennai 01 Apr, 2025

Global construction chemical brand requires Regional sales Mgr ( Project sales)- Bangalore /Chennai/Hyderabad One of our client aGlobal construction chemical MNC aa 100% subsidiary o...
project sales headconstruction chemical sales

Quality Engineer
AES INDUSTRIAL PRIVATE LIMITED 15.00 to 23.00 Years Hyderabad,China, Iran, Other Haryana, Other Bihar, South Korea, Other Assam, Iraq, Bangalore, Philip 01 Apr, 2025

Job brief
Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Staff Transaction Processing
YOUTAG INFOTECH PRIVATE LIMITED 15.00 to 24.00 Years Hyderabad,Kurung Kumey, Bangalore, Tarapur, Kadapa, Cachar, Pune, East Kameng, Itanagar, Other Andam 01 Apr, 2025

Join Accenture and help transform leading organizations and communities around the world. The sheer scale of our capabilities and client engagements and the way we collaborate, operate and delive...
staff retentionstaff assessmentstaff developmentstaff schedulingstaff managementstaff relationsstaff training

Urgent Opening for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 1.00 to 3.00 Years Hyderabad,Bangalore, Mohali, Chennai, Kolkata, Gurugram, Pune, Mumbai City, Itanagar, Other Arunacha 01 Apr, 2025

As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Financial Consultant (Agents) and coach them to sell life insurance policies and service customer...
direct salesb2b salesb2c salesinsurance salesclient servicinglife insurancebfsi saleslead generation

We are hiring for Frontline Sales Associate for Insurance Domain
SPECTRUM INSURANCE BROKING PRIVATE LIMITED 0.00 to 3.00 Years Hyderabad,Bangalore, Srikakulam, Ongole, Chennai, Vizianagaram, Guntakal, Kolkata, Mumbai City, Anan 01 Apr, 2025

Are you good at networking and training teams If yes, then this is the right job for you! As a Front Line Sales (FLS) employee in Agency channel, you will leverage your network to recruit Finan...
life insurancesalesclient servicinglead generationbfsi salesb2b salesinsurance salesb2c sales

WALK-IN Drive Java Full Stack Developer(Internship) Hyderabad
GLOBEX DIGITAL SOLUTIONS PRIVATE LIMITED Fresher Hyderabad 01 Apr, 2025

Warm Greeting for the Day! WALK-IN Drive for Java Full Stack Developer Internship Program(Without Stipend) which for Hyderabad Location. Dates:1-April-2025 to ...
javajavascriptmicroservices

Senior Ar Caller - Hospital Billing
AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Mumbai City 01 Apr, 2025

HIRING FOR AR CALLER / SENIOR AR CALLER !! Experience : Minimum 1Year Location : Mumbai, Hyderabad

Minimum 1 Years of experience ...
ub04cms-1500denial managementar callingmedical billingar calling medical billingus healthcareclient partnerar caller

Clinical Data Management
CLIN BIOSCIENCES 0.00 to 1.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Responsibilities:

Design and build eCRFs within Medidata Rave, ensuring adherence to protocol and data standards.<...
argus safetyarisgdrug safety

AR Caller / Senior AR Caller - Denial Management
AATRAL HR CONSULTING LLP 1.00 to 6.00 Years Hyderabad,Bangalore, Pune, Mumbai City 01 Apr, 2025

Experience and Skills Required

Minimum 1 Years of experience in AR Caller (Voice)

Knowledge of Physician Billing or Hospital Billing and D...
ub04us healthcaremedical billingcms-1500ar callingar calling medical billing

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Hyderabad,Noida 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Automation Testing
Srijan Spectrum Pvt Ltd 8.00 to 13.00 Years Hyderabad,Bangalore, Noida, Chennai, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Automation Engineer Exp : 9 - 15 Notice : 0 - 30 Days Location : Remote Skills : UI Automation, ETL Automation, UAT Testing Timing : 12.30 PM - 9.30 PM Must Have Lead experience ui testinguat

RELIANCE LIFE INSURANCE - SPOT OFFER - ON ROLE - HIGH CTC - PAN INDIA
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad,Bangalore, Chennai, Noida, Gurugram, Kolkata, Pune, Mumbai City, Delhi 01 Apr, 2025

Job Role : Senior Relationship Manager, Greetings! Roles & Responsibilities,

Candidate has to work on the leads provided by the Organization.

Cand...
life insuranceagent recruitment

Insurance Sales
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Hyderabad 01 Apr, 2025

Job Summary: As a Frontline Sales Representative, you will interact directly with customers to generate leads, drive sales, and build long-term rel...
frontinsurancesaleslinedirect

Agency Development Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 4.00 Years Hyderabad 01 Apr, 2025

We are pleased to offer you the chance to advance your career with one of Indias top three most trusted life insurance brands, as recognized in the Brand Equity Most Trusted Brands Survey 2018. W...
insurance agency managementchannel partnersdirect salesagency sales

Design Intern
swifnixcom 0.00 to 4.00 Years Gwalior,Other Madhya Pradesh 01 Apr, 2025

Required Skills and Qualifications: Proficiency in design tools such as Adobe Creative Suite (Illustrator, Photoshop, InDesign) or Sketch, Figma, or similar. Strong understanding of design princ...
Adobe Creative SuiteCoral DrawHTMLCSSJavaScriptSketchFigma

Requirement in Agency Development manager for Life Insurance CTc upto 5.5 lacs
ATS Infovision 3.00 to 8.00 Years Gwalior,Bhopal, Jabalpur, Solapur, Rajkot, Pune, Aurangabad, Surat, Nagpur 01 Apr, 2025

Dear Candidates, Greetings of the day! Candidate Qualifications:

Previous Sales Experience: Proven success in a sales role, prefe...
agency developmentagent recruitmentunit manager

Hiring Hiring Agency Development Manager For Life Insurance salary 4.5
Niyukti Management Consultants Hiring For Niyukti Management Consultants 5.00 to 10.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Jaipur, Jodhpur, Udaipur, Pune, Nagpur 01 Apr, 2025

Agency Development Manager Life Insurance Comp Location Salary- Upto 4lac Rimb Incentive Exp- 2-10Year sal...
salesdirect salesagency salessales development managerunit managerrelationship managersales executiveagency development manager

Posting Insurance Sales Manager
Niyukti Management Consultants Hiring For Niyukti Management Consultants 3.00 to 8.00 Years Gwalior,Ujjain, Indore, Bhopal, Jabalpur, Patiala, Amritsar, Jalandhar, Ludhiana, Delhi 01 Apr, 2025

Job Description / Responsibilities:

life insurancesalesdevelopment managerdistribution manageragency development managersales officersales executive

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Gwalior,Indore, Bhopal, Jabalpur, Ratlam, Sagar, Ernakulam, Pala, Wayanad, Thiruvananthapuram 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Profiles to be source-Agency Direct - in Life Insurance
ATS Infovision 2.00 to 7.00 Years Gurugram,Dehradun 01 Apr, 2025

Dear Candidates Greetings of the Day, We are the leading Job Consultancy for BFSI Sector and have tieup with almost all major life Insurance companies for recruitment...
life insurancebusiness developmentagency developmentagency channelassociate development

Cluster Head - ADRV Insurance Team Handling Profile Salary Upto 14Lac
Niyukti Management Consultants 10.00 to 17.00 Years Gurugram,Delhi, Noida, Lucknow, Pune, Mumbai City 01 Apr, 2025

We are currently hiring for a key position and would like to share the updated requirements with you. Kindly review the details below: Key Specifications:
insurance agency managementinsurance saleslocation headterritory managerbranch headbranch managerchief branch managerarea manager

Travel Sales Consultant
IMPACT UNIVERSAL XPERTS 1.00 to 3.00 Years Gurugram,Delhi 01 Apr, 2025

US Flight Sales - English 2 Years of exp in Travel Sales (US Flight Sales) Knowledge of GDS ( Amadeus & sabre) Excellenct Communication & Interpersonal Skills Preferably from ...
amadeus gdstravel sales

Retail Head Location- Gurugram
THE TALENT KEEPERS 10.00 to 20.00 Years Gurugram 01 Apr, 2025

Knowledge of handling multiple stores with P&L accountability.

Understanding of Fusion software including opening of item masters, vendor codes, PO generations, and other aspects upto ...
inventorysupervisionmanagementstoreretailoperation

Sr. Electrical Design Engineer
JustHR 8.00 to 13.00 Years Gurugram 01 Apr, 2025

Role: Electrical Engineer Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us Wearecreating a platform for passionate engineer...
powerautocadbuildingdistributiondesignetapengineerelectrical

Sr. Managing Partner APC Life Insurance Company salary upto 7Lac
Niyukti Management Consultants 6.00 to 11.00 Years Gurugram,Delhi, Faridabad, Noida, Karnal, Sirsa, Dehradun, Jaipur, Indore, Bhopal 01 Apr, 2025

Job Opening: Sr. Managing Partner APC Life Insurance Company Location: Delhi, Gurugram, Noida, Faridaba...
life insurancesalesunit managerbusiness development managerdeputy branch manager sourcingdevelopment managersales manageragency development managerbusiness manager

Business Development Manager
KKD Consulting Hiring For Clients 2.00 to 7.00 Years Gurugram,Faridabad, Ghaziabad, Noida, Panchkula, Mohali, Chandigarh, Mumbai City 01 Apr, 2025

KKD IS HIRING Job Title: Sales Manager - Agency Channel Company Overview: Join , a leading firm committed to innovation and excellence. Were ...
salesoutside sales

Sales Manager
Willpower Consultants Hiring For Axis Max Life Insurance 3.00 to 5.00 Years Gurugram,Delhi, Bangalore, Indore, Chennai, Kurnool, Ujjain, South Goa, North Goa 01 Apr, 2025

We are looking for a motivated Associate Agency Development Manager to support the recruitment, training, and growth of agency teams. The ideal cand...
marketingsales

Hvac Design Engineer
JustHR 14.00 to 20.00 Years Gurugram 01 Apr, 2025

Role: Lead/Principal Mechanical Engineer - HVAC Design Location: Gurgaon, India Profession/Role type: Engineering/Individual Contributor Employment type: Full-Time About us We arecreating a p...
designplumbingmepbimhvacrevitsystem

Openings for Life Insurance Sector- Delhi location (CTC up to 5 LPA)
ATS Infovision 1.00 to 6.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidates, Greetings of the day! You can contact us on Mobile No. : hidden_mobile or just a message on whatsapp with Yes to get a call back <...
direct salesinsurancecasa salesbankingfield workdirect channel saleslife insurancedirect marketing

Equity Dealer
Apex Services Hiring For One of the leading broking firm 1.00 to 5.00 Years Gurugram,Delhi, Noida, Jaipur, Chandigarh 01 Apr, 2025

Dear Candidate, Greetings From APEX SERVICES Role-EquityDealer share marketcross sellingthird party productsclient acquisitionequity dealer

Hiring For Online Marketing Executive (Work From Home Or Office Both) DELHI-NCR
Desnor Destination Pvt Ltd 0.00 to 4.00 Years Gurugram,Delhi, Faridabad, Ghaziabad, Noida 01 Apr, 2025

Dear Candidate Greetings fromDesnor Destination Pvt Ltd ! Job Summary Idealises Internet Marketing Agency is looking for Marketing Executive to join our dynamic team and embark on a rewarding...
marketing planningdigitaldisplay advertisingmarketingfreelancingwork from homemarketing communicationpart time

Head Admin
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 5.00 to 10.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Pune, Mumbai City 01 Apr, 2025

Main Responsibilities:

Strategic Planning:

Identify opportunities for operational efficiency and cost savings within the administrative functions.

Prepare an...
administration managementoffice operationstravel deskfacility managementfacility operationscorporate administration

Full Stack Developer
LTIMindtree Limited 6.00 to 10.00 Years Noida,Hyderabad 01 Apr, 2025

Job Description Develop maintain enhance and test client systems of moderate to high complexity Execute full software development life cycle SDLC build highquality innovative and performing sof...
sdlcjavaaws

Quality Assurance Engineer
MACKENZIE MODERN IT SOLUTIONS PRIVATE LIMITED 3.00 to 8.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

The QA technician role plays an important part in our companys product development process. Our ideal candidate will be responsible for conducting tests before product launches to ensure softwar...
automation testingmanual testingprocessqa analystquality analysttest engineerqualitytestingtest managerqa manager

Business Development Manager
ADITYA BIRLA SUN LIFE INSURANCE COMPANY LIMITED 1.00 to 2.00 Years Gurugram,Delhi, Faridabad, Ghaziabad 01 Apr, 2025

Designation:Agency Manager Education:Any Graduates Experience:Fresher with Good network / Min. 1 Yearin anyDomain Sal...
salesinsuranceagency channelbfsi sales

Business Associate
ALTSEO PRIVATE LIMITED 15.00 to 25.00 Years Gurugram,Delhi, Noida, Bangalore, Chennai, Hyderabad, Kolkata, Pune, Mumbai City 01 Apr, 2025

We are looking for an energetic business development associate to help drive our sales and grow the business. You will attract new clients and build solid relationships with them while maintainin...
visualizationsalesservicemanagementmarketingterminologycommunicationcustomerprojectmedicalstatementsskills

for Sales Warrior & Relationship Manager
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Other Kerala,Chennai, Other Tamil Nadu 01 Apr, 2025

JobDescription Direct Marketing Channel Designation: Sr. Relationship Manager/Executive Relationship Manager Roles & Responsibilities...
agency channelsalesinsurance salesmarketingbusinessagency

Hiring for Sales Warrior- Kerala
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 1.00 to 6.00 Years Kannur,Kochi, Other Kerala 01 Apr, 2025

RNLIC - Hiring for Kerala Location. All the localite of Kerala - Opportunity for work on on role with RNLIC Direct Marketing Channel ...
agency channelsalesbfsiagencybusinessinsurance sales

OVERHEAD TRANSMISSION LINE EGINEER AND TECHNICIAN
CAREER ZONE STAFFING SOLUTIONS 8.00 to 13.00 Years Ernakulam,Idukki, Kochi, Kottayam, Wayanad, Other Kerala, Bangalore, Other Tamil Nadu, Chennai, Ahme 01 Apr, 2025

WE REQUIRE ENGINEERS, TECHNICIAN, TEAM LEADER, SUPERVISOR AND FOREMAN FOR AN OVERHEAD TRANSMISSION LINE(OHTL). MINIMUM OF 8 TO 10 YEARS EXPERIENCE REQUIRED IN OHTL. AGE LIMIT UPTO 40 YEARS OLD. ...
power distributionelectrical engineeringpower transmissionelectrical maintenance

Product Manager
RAJPUT PROTECTION SERVICE PRIVATE LIMITED 15.00 to 25.00 Years Ernakulam,Wayanad, Pala, Thiruvananthapuram, Gwalior, Indore, Jabalpur, Bhopal, Ratlam, Sagar 01 Apr, 2025

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

3D Visualizer
ED Group Pvt Ltd 1.00 to 5.00 Years Kochi,Other Kerala 01 Apr, 2025

We are hiring! Position: 3D Visualizer Experience: 1-2 years** Location: Kochi, Kerala Only apply if you are proficient using Sketchup, Lumion and D5 Render.* Key Responsibilities: Create hig...
SketchupLumionAutoCAD

Front Office Assistant
Five Star Resort 1.00 to 5.00 Years Other Kerala 01 Apr, 2025

FRONT OFFICE ASSISTANT VACCANCY AVALIBLE AT NIRAAMAYA RETREATS KUMARKOM KOTTAYAM 1. MALES PREFERED 2. HANDLE ALL THE OPERATIONS OF FRONT OFFICE 3.MUST BE CONFIDENT IN MANAGING GUEST 4.MUST BE ...
English

Full Stack Development
AL RAZ International Business Links 1.00 to 5.00 Years Other Kerala 01 Apr, 2025

experienced Full Stack Development Faculty to join our team. The ideal candidate should have a strong background in both front-end and back-end technologies and a passion for teaching and mentorin...
PythonTeachingMentoringCommunicationPresentationFull Stack DevelopmentFrontend technologies

PREV
NEXT

life insurance agency background only Job Openings

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Job brief

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod... goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Job Description / Responsibilities:

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c... product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Were currently seeking a highly skilled and experienced Quality Engineer to join our team. In this role, you will be responsible for ensuring the safety and quality of our prod...
goodqualityanalyticalsupplier qualityengineering change managementquality managementengineer

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing

Job brief We are looking for an experienced Product Manager who is passionate about building products that customers love. You will join a dynamic and fast-paced environment and work with c...
product sourcingproduct marketingproduction engineeringproduct managementproduct manufacturing