offering financial advice jobs

Hyderabad Jobs
Banglore Jobs
Chennai Jobs
Delhi Jobs
Ahmedabad Jobs
Mumbai Jobs
Pune Jobs
Vijayawada Jobs
Gurgaon Jobs
Noida Jobs

Oil & Gas Jobs
Banking Jobs
Construction Jobs
Top Management Jobs
IT - Software Jobs
Medical Healthcare Jobs
Purchase / Logistics Jobs
Sales

Ajax Jobs
Designing Jobs
ASP .NET Jobs
Java Jobs
MySQL Jobs
Sap hr Jobs
Software Testing Jobs
Html Jobs

IT Jobs
Logistics Jobs
Customer Service Jobs
Airport Jobs
Banking Jobs
Driver Jobs
Part Time Jobs
Civil Engineering Jobs
Accountant Jobs
Safety Officer Jobs
Nursing Jobs
Civil Engineering Jobs
Hospitality Jobs
Part Time Jobs
Security Jobs
Finance Jobs
Marketing Jobs
Shipping Jobs
Real Estate Jobs
Telecom Jobs

offering financial advice Job Openings

Showing 32251 - 32300 of 34388 Jobs

Asst Manager - Private Equity Fund Accountin

NTT Global Delivery Services Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Roles and Responsibilities

Review Booking Journal Entries basis bank statements and client
Review of Bank Reconciliation and maintaining the respectiv...
cash flowhedge fundsprivate equityjournal entriesbank statementsfinancial reportingbank reconciliationfinancial justificationcashcapitalbespokeexpensesreportingportfoliomanagementmonitoringmaintenanceperformanceliabilities

Vendor Management New Associate-Procurement management

Accenture 0.00 to 1.00 Years Gurugram 12 Oct, 2023

Skill required: Procurement management - Vendor Management

Designation: Vendor Management New Associate

Job Location: G...
accounts payableaccounts payablereceivableapproval processbudgetingcreditroot causeissue resolutionvendor managementthought leadershipclient relationshipsupplier enablementcommunication skillsprofessional servicesperformance measurement

Automation Engineer
INFOCOMX TECHNOLOGIES PRIVATE LIMITED 4.00 to 8.00 Years Delhi 12 Oct, 2023

Job Title: Project Senior Engineer - Electrical Systems (Grain Processing Industry) Company Overview: SATAKE INDIA ENGINEERING is a leading engineering firm of Japanese origin specializing in pro...
project engineeringsite engineering

HR Executive cum Admin
LIVE-WIRE CONSULTANCY SERVICES 1.00 to 3.00 Years Gurugram 12 Oct, 2023

Hiring:HR ExecutiveCumAdmin Position:2 Location: Delhi/NCR Salary: 20hidden_mobile0 General Admin Responsibilities: Create and update records and databases with pe...
human resource managementhr operations

Store Manager
Garima Interprises Hiring For Garima Interprises 1.00 to 6.00 Years Gurugram 12 Oct, 2023

A store manager is responsible for overseeing the daily operations of a store, making sure it runs smoothly and effectively. Their duties include motivating sales teams, creating business strateg...
customer servicecommunication skillsproblem solvingdecision-makingretail

Insurance Sales Officer
STAFFIK SERVICO LLP 0.00 to 4.00 Years Gurugram 12 Oct, 2023

WE are hiring for insurance sales candidate for Banca channel , direct channel Sales / BD, Field Sales Executive
...
key account managementbancassurance saleslife insuranceagency salessenior relationship managerfinancial consultantsales managersales development manager

Assistant Relationship Manager
TMI Group 1.00 to 6.00 Years Delhi 12 Oct, 2023

About the Company: Welcome to Aditya Birla capital. A leading financial service Part of the global Aditya Birla ecosystem. Aditya Birla Group capital is driven by an ex...
direct marketingdirect sales

Account Executive
Cocentrus Hiring For Delhi 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring for Account Executive Profile for East Delhi IP Extension location. Please find the details as below :- Job Profile :Account Executive ...
gsttdstally erpbookkeepingaccount executives

Sales Officer
Skywings Advisors Private Limited 0.00 to 4.00 Years Gurugram 12 Oct, 2023

Job Description
ROLES & RESPONSIBILITIES:

Quality acquisition of Home loans by going out into the market & catchment area.

Cross sell banking product l...
field salessaleshousing loanbankingloanslapcross sellingbanking sales

Recruiting for Finance & Assoc Prof- Construction Technology
Amity University 3.00 to 8.00 Years Noida 12 Oct, 2023

Asstt Prof- Finance & Assoc Prof- Construction Technology, Contracts, Project Management, Cost Management RICS School of Built Environment (RICSSBE), Amity University Uttar Pradesh, Noida invites ...
financial statement analysistrial balancerisk managementcost managementstock valuationproject planningcapital budgetingproject management

Operation Associate
SAFE LEDGER PRIVATE LIMITED Fresher Gurugram 12 Oct, 2023

About the Company: Registerkaro is a leading provider of finance accounting and taxation services, dedicated to assisting businesses in their formation and compliance needs. We o...
operationsfinancial reporting

Fashion Consultant
MICROFLAIR GLOBAL SOLUTIONS PRIVATE LIMITED 3.00 to 5.00 Years Gurugram 12 Oct, 2023

Job description 1. Candidate would be responsible for providing sales and services to the walk-in customers (Customer Interaction). 2. Greet the Customers & approach them by offering help & sug...
fashionfashion designing

HIRING Store Manager-Noida
Shree Balaji Enterprises 0.00 to 1.00 Years Noida 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
store managementordering

HIRING Store Manager-Faridabad
Shree Balaji Enterprises 0.00 to 1.00 Years Faridabad 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
salesstore management

HIRING Store manager-Ghaziabad
Shree Balaji Enterprises 0.00 to 1.00 Years Ghaziabad 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
store managementsales

HIRING Store manager-Delhi
Shree Balaji Enterprises 0.00 to 1.00 Years Delhi 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
salesstore management

HIRING Backoffice Assistant-Faridabad
Shree Balaji Enterprises 0.00 to 3.00 Years Faridabad 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officeback office

HIRING Backoffice Assistant-Delhi
Shree Balaji Enterprises 0.00 to 3.00 Years Delhi 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
ms officecrm

Finance Manager
Garima Interprises Hiring For Garima Interprises 5.00 to 8.00 Years Gurugram 12 Oct, 2023

Finance managers are business specialists who manage important financial functions of an organization. They produce financial reports, manage investment activities, and create strategies and plan...
organizationproblem solvingdecision-makingmathematicscommunication skills

Accountant
RISEOM TOOL CRAFTS PRIVATE LIMITED 3.00 to 8.00 Years Delhi 12 Oct, 2023

We are seeking trustworthy candidates who work efficiently without sacrificing accuracy. Accountants can expect to work with large amounts of numerical data, handle multiple tasks with deadlines,...
industrycommunicationgoodadaptabilitycollaborationknowledgesummaryskillsefficiencytime-saving

STORE MANAGER DELHI
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Delhi 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

Back Office Executive Faridabad
Nirmala Staffing Services 0.00 to 3.00 Years Faridabad 12 Oct, 2023

Experience- 0 to 3 years Salary- 4lkh Job description
Back Office Executive Duties

Previous work experience as an Office Executive.

Excellent organizational skills. backendback-end operationsback office operations

Accountant
S P Jagannath & Sons Hiring For Accountant 5.00 to 8.00 Years Delhi 12 Oct, 2023

ACCOUNTANT FRESHERS, PLEASE DO NOT APPLY SPJ Group has been a renowned group in the market since 19...
balance sheet finalisationtaxationaccountingaccounts finalisationbank reconciliationbranch accountingtaxgoods

US Accountant
Eveneum Solutions Private Limited 3.00 to 6.00 Years Delhi 12 Oct, 2023

Summary: We are looking for a highly motivated and experienced Bookkeeper/Accountant. The ideal candidate will have a strong understanding of US bookkeeping and accounting. asanaaccountingquickbooksexceladp payrollgood communication

Credit Analyst - Large corporates ( Gurgaon )
Topgear Consultants Private Limited 5.00 to 10.00 Years Delhi 12 Oct, 2023

Job Opening With a Leading Financial Services Company for position of Credit Analyst in Chennai Roles & Responsibilities - An...
financial analysiscreditcredit ratingcredit analysislarge coporatereport

JOIN INDIAS LARGEST LIFE INSURANCE COMPANY HIRING FOR PANINDIA
RELIANCE NIPPON LIFE INSURANCE COMPANY LIMITED 0.00 to 5.00 Years Delhi 12 Oct, 2023

Greetings Of the Day! Reliance Nippon Life Insurance is offering senior sales roles with HIGH CTC ON-ROLE EMPLOYMENT PREFERED LOCATIONS IN INDIA We are Hirin...
lead generationlife insuranceagency channelinsurancedirect marketingagent recruitmentinsurance salesirda

Store Manager Ghaziabad
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Ghaziabad 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

STORE MANAGER NOIDA
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Noida 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory planningstore operations

STORE MANAGER FARIDABAD
Oscar Medicare Pvt Ltd 0.00 to 1.00 Years Faridabad 12 Oct, 2023

Store Manager: Experience :3 Months To 1 Year Salary Budget:UpTo 2.50 LPA
Store Manager Responsibilities:
<...
store managementinventory controlstore operations

HR Executive cum Admin
LIVE-WIRE CONSULTANCY SERVICES 1.00 to 3.00 Years Delhi 12 Oct, 2023

Hiring:HR ExecutiveCumAdmin Position:2 Location: Delhi/NCR Salary: 20hidden_mobile0 General Admin Responsibilities: Create and update records and databases with pe...
human resource managementhr operations

Executive Assistant
Vibgyor Enterprises Hiring For Personal assistant 3.00 to 8.00 Years Delhi 12 Oct, 2023

Dear Candidate, Urgent opening forPersonal or Executive Assistant, for our end client (working into Financial and Agriculture domain- Mnc company) Working Location: Gur...
travel managementcalendar managementexecutive assistantpersonal secretarymeetings booking

Regional Manager
NATIONAL SEEDS CORPORATION LIMITED 10.00 to 20.00 Years Delhi 12 Oct, 2023

We are looking for an experienced regional manager to oversee our business operations in an assigned region. The regional manager will be responsible for leading and managing daily operations to ...
negotiationbusiness developmentregional managementdaily operationsplanningsupervisiontrainingbudget management

Area Sales Manager Chandigarh
Pride HR Solution 3.00 to 8.00 Years Chandigarh 12 Oct, 2023

Salary up to 8 lacs Minimum 3 years experience in Pharma sales. for More info- contact- hidden_mobile End-to-end ownership of business outcomes for...
medical salespharmaceutical salespharma marketingpharma sales

We have opening for Assistant Manager - Credit Cards
Bajaj Finserv Lending Ltd 1.00 to 2.00 Years Chandigarh 12 Oct, 2023

* Duties and Responsibilities - PRINCIPAL ACCOUNTABILITIES 1. Writing content for credit cards on various digital assets 2. Interacting with the marketing and the SEO team to update the current co...
salesmisaccountstatbankingcontent writingcustomer servicecustomer complaintscustomer experienceportfolio marketing

Associate / Sr Associate
Teamspace Financial Services Private Limited 2.00 to 7.00 Years Chennai 12 Oct, 2023

The role involves identifying and empanelling CAs, Ex-Bankers, Ex-Wealth advisors, Insurance agents and Finance professionals and empanelling them as independent fi...
investment portfoliob2bagency sales

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Chennai 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Senior Territory Sales Executive-Chennai
Abbott Healthcare 2.00 to 4.00 Years Chennai 12 Oct, 2023

Create a business plan to achieve targets that meet territory objectives by driving market traffic and optimizing product availability Identify potential towns, appoint d...
salesmarketingbusiness developmenttargetretaillearning management systemsbase paybusiness strategymanagement systemsaccounts receivablebehavioral trainingstock replenishmentlearning managementcompetitive landscapepospayisrcreditdemand

Deputy Manager
Aanya Placement Services 2.00 to 7.00 Years Chennai 12 Oct, 2023

Hiring For Banking:
Deputy Manager Deputy managers are in charge of overseeing the work of their ...
productionoperationstroubleshooting

Managing Consultant
Vaishnavi Services 14.00 to 24.00 Years Chennai 12 Oct, 2023

Managing consultants are responsible for overseeing the work of other consultants. They may also be responsible for managing client relationships, developing new business opportunities, and ensur...
agency coordinationstrategic account developmentconsultative sales managementinsurance agency managementstrategic account acquisitionmanaging agency relationshipsmajor account acquisitionmanaging benefitsaccount developement

Wealth Relationship Manager - Bank - Mumbai,Delhi
V-Konnect Associates Hiring For Bank 2.00 to 7.00 Years Bangalore 12 Oct, 2023

Roles and Responsibilities Manages the banking and investments relationship of clients and responsible for overall growth of Liabilities & Investment business from HNI/NRI/UHNI segment. Develops...
portfolio managementmutual funds saleswealth managementlife insurance

NRI Relationship Manager - Leading Bank
AV Global Advisory Services 4.00 to 6.00 Years Bangalore 12 Oct, 2023

Urgent Vacancy with Leading Bank Role - Manager - NRI Relationship Manager Location- Vishakhapatnam, Hyderabad, Bangalore, Chennai, Kerala, Co...
wealthnrinrrm

Home Loan Officer
LEVERAGE BUSINESS SOLUTIONS PRIVATE LIMITED 1.00 to 4.00 Years Bangalore 12 Oct, 2023

Position Overview: As a Home Loans Field Sales Representative, you will be a pivotal member of our lending team, responsible for expanding our customer base and ...
relationshipsaleshousing loanfieldhousing financelaphome loansloanexecutivemanager

Store Manager-Bangalore
Shree Balaji Enterprises 0.00 to 1.00 Years Bangalore 12 Oct, 2023

Store Manager Responsibilities:

Delivering excellent service to ensure high levels of customer satisfaction.

Motivating the sales team to meet sales objectives by tra...
salesstore management

Back Office Assistant-Bangalore
Shree Balaji Enterprises 0.00 to 3.00 Years Bangalore 12 Oct, 2023

Previous work experience as an Office Executive.

Excellent organizational skills.

Knowledge of computer operating systems and MS Office software.
back officecrm

Company recruit for Oracle PeopleSoft Grants
Accenture 2.00 to 4.00 Years Bangalore 12 Oct, 2023

About Accenture: Accenture is a leading global professional services company, providing a broad range of services in strategy and consulting, interactive, technology and operatio...
order to cashrecord to reportmodel designconceptual designbusiness process

Home Lending Risk Strategic Analytics - Associate
JPMorgan 0.00 to 4.00 Years Bangalore 12 Oct, 2023

The HL Risk Strategic Analytics team spans the globe, primarily sitting in Plano, TX and Bengaluru, India, however we have staff and executive presences across 9 locations worldwide: Plano TX, C...
source system analysismusic makingloan servicingrisk managementcapital marketsdata manipulationstrategic analyticsrelational databasescompatibility testingfinancial justificationmissassqlriskstemtrustoraclecredit

Real Estate Consultant
JM FINANCIAL PRODUCTS LIMITED 0.00 to 3.00 Years Bangalore 12 Oct, 2023

Dwello is hiring Consultant for real estate sale for Mumbai. OBJECTIVE: Thepersonwiththisrolewill real estate salescold calling

RestartWithInfosys-Oracle
Infosys Limited 2.00 to 4.00 Years Bangalore 12 Oct, 2023

This Program is for Women only! Women professionals who are on a career break, currently. These women should have worked for at least 2 years before taking a career break and should have a minimum...
client interfacing skillssoftware configuration managementteam managementproblem solvingsolution designmanagement systemsclient interfacingtechnology solutionsdigital transformationbusiness profitabilityconfiguration managementorganizational in

Heavy Construction Manager
AWINMO INDIA MARKETING PRIVATE LIMITED 9.00 to 14.00 Years Bangalore 12 Oct, 2023

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Sr Principal Engineer-Electrical
Baxter India 15.00 to 19.00 Years Bangalore 12 Oct, 2023

Sr Principal Engineer-Electrical This is where you save and sustain lives At Baxter, we are deeply connected by our mission. No matter your role at Baxter, your...
javajavascriptequipment supplyframeworksafety criticallinux

PREV
NEXT

offering financial advice Job Openings

ROLES & RESPONSIBILITIES:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Back Office Executive Duties Previous work experience as an Office Executive. Excellent organizational skills. backendback-end operationsback office operations

Store Manager Responsibilities:

Store Manager Responsibilities:

Store Manager Responsibilities:

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Hiring For Banking:

Deputy Manager Deputy managers are in charge of overseeing the work of their ... productionoperationstroubleshooting

Store Manager Responsibilities:

Dwello is hiring Consultant for real estate sale for Mumbai. OBJECTIVE: Thepersonwiththisrolewill real estate salescold calling

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear.... negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Jobs By Category

Jobs By Skills

Jobs By Location

Main Menu

Jobseekers

Employers

Back Office Executive Duties

Previous work experience as an Office Executive.

Excellent organizational skills. backendback-end operationsback office operations

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical

Deputy Manager Deputy managers are in charge of overseeing the work of their ...
productionoperationstroubleshooting

Heavy Equipment Operator Job Description Template We are searching for a skilled heavy equipment operator to utilize our industrial gear....
negotiation skillsriskcommunication skillsorganizationleadership skillsexecutive managementfinancemanagementfinancialcritical